TkA02G492350 | RubberDandelionOmics

Gene overview

TkA02G492350

Reference: TK1151 Chr: Chr02 Coordinates: 125868326-125869841 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · TkA02G492350|TK1151|cDNA

TTCGAAGTAACAATTTGCAGCTGATACGCGTATCTGATGGTAGTTGTCACTTTCTTATCCGCCTCAATACAGTTTACTCCTGATTGGGAAAACATGGCGACTTCGGGCATATGGCTGCCATTCCCGCTAACTTCTCCCTTCCCTCACTGTTATACTCATCTCCTTCGTCACAAACTTCTCGATCTTTCCTACGCAGAGCTCGATTCTCCTTCCGCTGCTCATCGTCGCTACCGCAACACGGTGGCCGATCAGGTTTTATG...

CDS

Download CDS FASTA

924 bp · TkA02G492350|TK1151|CDS

ATGGCTGCCATTCCCGCTAACTTCTCCCTTCCCTCACTGTTATACTCATCTCCTTCGTCACAAACTTCTCGATCTTTCCTACGCAGAGCTCGATTCTCCTTCCGCTGCTCATCGTCGCTACCGCAACACGGTGGCCGATCAGGTTTTATGGACTTCCCGTACGTCTCCGCCCCACACAAAAATATTATGGTAGATCTAGTATCCACCGTCGAAAGTCGCCTCGGCTCTTTACTTAATCCTTGCCGCCTCCCGCCTGATGT...

Protein

Download Protein FASTA

307 aa · TkA02G492350|TK1151|PROTEIN

MAAIPANFSLPSLLYSSPSSQTSRSFLRRARFSFRCSSSLPQHGGRSGFMDFPYVSAPHKNIMVDLVSTVESRLGSLLNPCRLPPDVQSYQNDSGTAHAALHLRSGVHSSQIDFILGSWLHCELPSGGALNITSLSAYLNSSTDAPNLLVELIQSSPTSVVLILDLPHRKELVLNPDYLKTFYEDTQLDQHRQHLEKLPEVTPYFSSSLYIRSVVSPTAILVRIETEQLDEMIETHVTPIAKQVLNTWLDVCAFGERVVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G492350`
TK1151 ID	TkA02G492350
OH-1004 ID	LXL04_013518
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 97.152 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G492350

Location Chr02:125868326-125869841 (+)

Description Similar to RCCR: Red chlorophyll catabolite reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37000`	Catalyzes the key reaction of chlorophyll catabolism, porphyrin macrocycle cleavage of pheophorbide a (pheide a) to a primary fluorescent catabolite (pFCC).	Molecular cloning, functional expression and characterisation of RCC reductase involved in chlorophyll catabolism.2000 · DOI: 10.1046/j.1365-313x.2000.00667.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0389200`	Catalyzes the key reaction of chlorophyll catabolism, porphyrin macrocycle cleavage of pheophorbide a (pheide a) to a primary fluorescent catabolite (pFCC).	Knockdown of OsPAO and OsRCCR1 cause different plant death phenotypes in rice.2011 · DOI: 10.1016/j.jplph.2011.05.026

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013518 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010363 regulation of plant-type hypersensitive response Biological Process

GO:0015996 chlorophyll catabolic process Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ag:CAB77705

ath:AT4G37000

dosa:Os10g0389200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.836

Rank 1 · TkA02G492350 · TK1151

Nucleus0.129

Rank 2 · TkA02G492350 · TK1151

Mitochondrion0.076

Rank 3 · TkA02G492350 · TK1151

Cytoplasm0.069

Rank 4 · TkA02G492350 · TK1151

Cell membrane0.038

Rank 5 · TkA02G492350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06405RCC_reductase58-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G492350	`PF06405`	RCC_reductase	58	305	7.9e-117	389.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LDU4`	Arabidopsis thaliana	sp\|Q8LDU4\|RCCR_ARATH Red chlorophyll catabolite reductase, chloroplastic	57.100%	Swiss-Prot	High
`Q338P6`	Oryza sativa subsp. japonica	sp\|Q338P6\|RCCR1_ORYSJ Red chlorophyll catabolite reductase 1, chloroplastic	43.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card