TkA02G490920 | RubberDandelionOmics

Gene overview

TkA02G490920

Reference: TK1151 Chr: Chr02 Coordinates: 125493224-125495038 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1335 bp · TkA02G490920|TK1151|cDNA

CCCACCTCTCTCTCACCGTCTGCAATCAAGATTCTTGCCGAAGAACAAGGCTCCAAATGCCGCGATACGATTACAATATCATCTTCGTCGTCAACATATTATTTGCAGCAACTATTTGTTCTATTTGTTCAACATCTCTAAAGATCGGAGAAACATGTTCTATGGACGACAACCAATGCGACGACGGGTTGCGTTGTGGAACATGCTCTGCCAGTGGCAACACCCGCCCTAGATGCACCCGCATCCAACCAATCAATCCT...

CDS

Download CDS FASTA

1242 bp · TkA02G490920|TK1151|CDS

ATGCCGCGATACGATTACAATATCATCTTCGTCGTCAACATATTATTTGCAGCAACTATTTGTTCTATTTGTTCAACATCTCTAAAGATCGGAGAAACATGTTCTATGGACGACAACCAATGCGACGACGGGTTGCGTTGTGGAACATGCTCTGCCAGTGGCAACACCCGCCCTAGATGCACCCGCATCCAACCAATCAATCCTACTTCAAAGGTGAATGGCCTTCCGTTTAATCGGTATACGTGGCTGACGACTCATAA...

Protein

Download Protein FASTA

413 aa · TkA02G490920|TK1151|PROTEIN

MPRYDYNIIFVVNILFAATICSICSTSLKIGETCSMDDNQCDDGLRCGTCSASGNTRPRCTRIQPINPTSKVNGLPFNRYTWLTTHNSFALSGSKLPNGLPVLGPANQEDDVTSQLQNGVRGLMLDMYDFNDDIWMCHSFGGICYNITAYQPAINVLREIQKFLEENPTEIITIFIEDYVTSQNGLTKVFNESGLIRYMFPSYRMPKEGAEWPLITDMVTRNQRLVVFTSKSSKEASEGFAYEWTYVVENQYGNDGKIAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G490920`
TK1151 ID	TkA02G490920
OH-1004 ID	LXL04_013541
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G490920

Location Chr02:125493224-125495038 (-)

Description Similar to At5g67130: PI-PLC X domain-containing protein At5g67130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67130`	PI-PLC X domain-containing protein At5g67130.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013541 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0007165 signal transduction Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0008081 phosphoric diester hydrolase activity Molecular Function

KEGG gene cross-reference

abe:ARB_04618

abe:ARB_08043

ath:AT5G67130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.433

Rank 1 · TkA02G490920 · TK1151

Extracellular0.194

Rank 2 · TkA02G490920 · TK1151

Lysosome / Vacuole0.120

Rank 3 · TkA02G490920 · TK1151

Cytoplasm0.102

Rank 4 · TkA02G490920 · TK1151

Endoplasmic reticulum0.083

Rank 5 · TkA02G490920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11331Zn_ribbon_1220-52 aa

PF00219IGFBP21-47 aa

PF26178Rv2075c_cat74-182 aa

PF26146PI-PLC_X106-329 aa

PF00388PI-PLC-X106-184 aa

PF25506TIM-barrel_MTC6110-167 aa

PF04791LMBR1135-200 aa

PF25506TIM-barrel_MTC6210-285 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G490920	`PF11331`	Zn_ribbon_12	20	52	0.044	14.3
TkA02G490920	`PF00219`	IGFBP	21	47	4.2	8.8
TkA02G490920	`PF26178`	Rv2075c_cat	74	182	0.0053	16.7
TkA02G490920	`PF26146`	PI-PLC_X	106	329	8.1e-23	81.9
TkA02G490920	`PF00388`	PI-PLC-X	106	184	0.0029	18.0
TkA02G490920	`PF25506`	TIM-barrel_MTC6	110	167	0.069	13.3
TkA02G490920	`PF04791`	LMBR1	135	200	0.15	11.6
TkA02G490920	`PF25506`	TIM-barrel_MTC6	210	285	0.069	13.3
TkA02G490920	`PF00219`	IGFBP	346	354	4.2	8.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93XX5`	Arabidopsis thaliana	sp\|Q93XX5\|Y5713_ARATH PI-PLC X domain-containing protein At5g67130	51.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card