Gene Card
Gene overview
cDNA / CDS / Protein Sequences
450 bp · TkA02G490550|TK1151|cDNA
ATGAATAGTGAAGTCAAACTTGAACAGTGCATCAACGTGGCTTTTCTCCCTAAATCGACGGGATTGTCCTTCTCCTCATCCAATCTTAGCTCCAATAATGATACCGCCATAGCAGTTTCTCAGAGCTTTGTTGAATCTCAACATCCCCCAAACGAATCGGAACAGGTACATGCGGCTTCAAATTCATGCCCTAATTCCCCAATCTCCTCCCAACACACCAGAACATGGCCTCTTCCGGAGACGAGATCTTCCATGAGAGA...
450 bp · TkA02G490550|TK1151|CDS
ATGAATAGTGAAGTCAAACTTGAACAGTGCATCAACGTGGCTTTTCTCCCTAAATCGACGGGATTGTCCTTCTCCTCATCCAATCTTAGCTCCAATAATGATACCGCCATAGCAGTTTCTCAGAGCTTTGTTGAATCTCAACATCCCCCAAACGAATCGGAACAGGTACATGCGGCTTCAAATTCATGCCCTAATTCCCCAATCTCCTCCCAACACACCAGAACATGGCCTCTTCCGGAGACGAGATCTTCCATGAGAGA...
Protein
Download Protein FASTA149 aa · TkA02G490550|TK1151|PROTEIN
MNSEVKLEQCINVAFLPKSTGLSFSSSNLSSNNDTAIAVSQSFVESQHPPNESEQVHAASNSCPNSPISSQHTRTWPLPETRSSMRDEDILSSRLIVRSSSCSSTPAVGNCPPSSKFSSTSLCARSLNLSISSSHNSFKSNCLPHNRPM
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G490550 |
|---|---|
| TK1151 ID | TkA02G490550 |
| OH-1004 ID | LXL04_009933 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 91.600 |
| Protein coverage (%) | TK1151 87.919 / OH-1004 24.259Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G490550 |
|---|---|
| Location | Chr02:125413415-125413864 (-) |
| Description | Similar to EDE1: Protein ENDOSPERM DEFECTIVE 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000226 microtubule cytoskeleton organization Biological Process GO:0009658 chloroplast organization Biological Process GO:0009960 endosperm development Biological Process GO:0010342 endosperm cellularization Biological Process GO:0048316 seed development Biological Process GO:0051225 spindle assembly Biological Process GO:0051301 cell division Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005777 peroxisome Cellular Component GO:0005874 microtubule Cellular Component GO:0005880 nuclear microtubule Cellular Component |
| KEGG gene cross-reference | ath:AT2G44190 ath:AT3G19570 ath:AT3G60000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.