TkA02G488490 | RubberDandelionOmics

Gene overview

TkA02G488490

Reference: TK1151 Chr: Chr02 Coordinates: 124918980-124922869 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2270 bp · TkA02G488490|TK1151|cDNA

TTATGCAATTTTAAAAGGGCAGAATCATGGGCCCAACGGCTATAAAAAATTAAAAAAAGACTGAAAGCCCAAATGTATATTTTTGTGTTGGATCAATTTTGGCCCAAATGTAAGCCCATATAAAGCAACTCAAACGTTACAAACTAGGTGCCTACTGCCTACTACCCAAATTTTATACCAGCGATTTCTTACGGTTTAGATTTAGACACAAGCAGAGCACTCGTTTCCTGTTCAAGCTACCAAAATGGCAGACAATGGAG...

CDS

Download CDS FASTA

1701 bp · TkA02G488490|TK1151|CDS

ATGGCAGACAATGGAGTGCTGCCGGTCGACAAGTTAACAATTTCCGACACTGTCGAAGAAGCCGAGTTCTCACAGCGTGTACTGATTCGATCAATTCTGGGCCGTCCGGACGGCGGCGCTGGCCTTGCTGGGAAGACCTTGAGGGTCGGCGGCTGGGTGAAGAAAGGTCGAGAACAAGGCAAAGGTTCATTTGCCTTTCTTGAACTTAACGACGGATCTTGTCCGGCGAACCTCCAGCTTATAATATACTCGGATGTAGC...

Protein

Download Protein FASTA

566 aa · TkA02G488490|TK1151|PROTEIN

MADNGVLPVDKLTISDTVEEAEFSQRVLIRSILGRPDGGAGLAGKTLRVGGWVKKGREQGKGSFAFLELNDGSCPANLQLIIYSDVAPLGQFTPTGTCLHVEGVLQMPPADKQGKQSIELKVSKVLDIGAADPAKYPLPKTRLTLEFLRDYVHLRPRTNTISSIARIRNALAYATHTFFQKHGFLYVHTPIITTSDCEGAGEMFQVTTLINDSEKLEKELIKNPPPSQQDVDTARAAVKEKGEIVAKLKSDKAGKPAITA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G488490`
TK1151 ID	TkA02G488490
OH-1004 ID	LXL04_013571
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G488490

Location Chr02:124918980-124922869 (-)

Description Similar to SYNC1: Asparagine--tRNA ligase, cytoplasmic 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56680`	Asparagine--tRNA ligase, cytoplasmic 1.	No verified direct reference in this release
`At1g70980`	Asparagine--tRNA ligase, cytoplasmic 3.	No verified direct reference in this release
`At4g17300`	Asparagine--tRNA ligase, chloroplastic/mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013571 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006421 asparaginyl-tRNA aminoacylation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0048481 plant ovule development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0004816 asparagine-tRNA ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G70980

ath:AT3G07420

ath:AT4G17300

ath:AT5G56680

sfu:Sfum_2475

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.592

Rank 1 · TkA02G488490 · TK1151

Mitochondrion0.257

Rank 2 · TkA02G488490 · TK1151

Nucleus0.207

Rank 3 · TkA02G488490 · TK1151

Peroxisome0.081

Rank 4 · TkA02G488490 · TK1151

Cell membrane0.043

Rank 5 · TkA02G488490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01336tRNA_anti-codon48-125 aa

PF00152tRNA-synt_2148-211 aa

PF25876HH_MFP_RND219-253 aa

PF24111DUF7386235-279 aa

PF00458WHEP-TRS236-276 aa

PF25876HH_MFP_RND260-277 aa

PF00152tRNA-synt_2296-559 aa

PF01409tRNA-synt_2d325-348 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G488490	`PF01336`	tRNA_anti-codon	48	125	4.3e-07	30.5
TkA02G488490	`PF00152`	tRNA-synt_2	148	211	8.7e-59	199.8
TkA02G488490	`PF25876`	HH_MFP_RND	219	253	0.23	12.5
TkA02G488490	`PF24111`	DUF7386	235	279	0.016	16.2
TkA02G488490	`PF00458`	WHEP-TRS	236	276	8.2e-06	26.5
TkA02G488490	`PF25876`	HH_MFP_RND	260	277	0.23	12.5
TkA02G488490	`PF00152`	tRNA-synt_2	296	559	8.7e-59	199.8
TkA02G488490	`PF01409`	tRNA-synt_2d	325	348	0.021	15.0
TkA02G488490	`PF24111`	DUF7386	383	414	0.016	16.2
TkA02G488490	`PF01409`	tRNA-synt_2d	529	554	0.021	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SW96`	Arabidopsis thaliana	sp\|Q9SW96\|SYNC1_ARATH Asparagine--tRNA ligase, cytoplasmic 1	69.600%	Swiss-Prot	High
`Q9SSK1`	Arabidopsis thaliana	sp\|Q9SSK1\|SYNC3_ARATH Asparagine--tRNA ligase, cytoplasmic 3	67.900%	Swiss-Prot	High
`O48593`	Arabidopsis thaliana	sp\|O48593\|SYNO_ARATH Asparagine--tRNA ligase, chloroplastic/mitochondrial	49.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card