TkA02G488480 | RubberDandelionOmics

Gene overview

TkA02G488480

Reference: TK1151 Chr: Chr02 Coordinates: 124917615-124918702 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

984 bp · TkA02G488480|TK1151|cDNA

ATGGCCGACAAGCGGCGTCAACATCAGACGCCCAAGCGAGTGGTGGTACGGCCGCGGCTTCCTCGCATTTCATATGTGCGACGGCGGCCGCTCTCATCCTTAGCGCATACCAGCTTCAATCTCCACCGTTCACTCGCCCAAGATCTTAACGGATCCCGATCCTACGGTTACCGTCCACTTACGGCTGTCACCATCTCCATCGACAAATCCAAACCACCACAACCAGCAACCTCTATTCTCCCGTCGTGGGTAAACGGCGG...

CDS

Download CDS FASTA

984 bp · TkA02G488480|TK1151|CDS

ATGGCCGACAAGCGGCGTCAACATCAGACGCCCAAGCGAGTGGTGGTACGGCCGCGGCTTCCTCGCATTTCATATGTGCGACGGCGGCCGCTCTCATCCTTAGCGCATACCAGCTTCAATCTCCACCGTTCACTCGCCCAAGATCTTAACGGATCCCGATCCTACGGTTACCGTCCACTTACGGCTGTCACCATCTCCATCGACAAATCCAAACCACCACAACCAGCAACCTCTATTCTCCCGTCGTGGGTAAACGGCGG...

Protein

Download Protein FASTA

327 aa · TkA02G488480|TK1151|PROTEIN

MADKRRQHQTPKRVVVRPRLPRISYVRRRPLSSLAHTSFNLHRSLAQDLNGSRSYGYRPLTAVTISIDKSKPPQPATSILPSWVNGGVKKGEIIGTEETTAQIHPQLFTRTLLAKAVADHGVEVIIAKVESAVVEDEGVAVKLDTGRVIGGDAVVLALGPWTSMLPEISSIFRVYGKKVHSVVLEPNDGEAITPHALFTTYYPGNGTGPIDPEVYPRPTGEVYICGPSVKAEIPEKPELVIPESESIELLKKVGGMVSSH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G488480`
TK1151 ID	TkA02G488480
OH-1004 ID	LXL04_024368
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	56.900
Protein coverage (%)	TK1151 83.180 / OH-1004 71.802 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G488480`
Location	Chr02:124917615-124918702 (+)
Description	Similar to SPAC1F5.03c: Putative oxidoreductase C1F5.03c (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024368` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0019740 nitrogen utilization Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0005737 cytoplasm Cellular Component GO:0005770 late endosome Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0003884 D-amino-acid oxidase activity Molecular Function GO:0008445 D-aspartate oxidase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function
KEGG gene cross-reference	bsu:BSU32630 sce:YHR009C spo:2541471 spo:2542382 zma:100037820 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.558

Rank 1 · TkA02G488480 · TK1151

Peroxisome0.288

Rank 2 · TkA02G488480 · TK1151

Nucleus0.237

Rank 3 · TkA02G488480 · TK1151

Mitochondrion0.091

Rank 4 · TkA02G488480 · TK1151

Plastid0.040

Rank 5 · TkA02G488480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01134GIDA97-167 aa

PF01266DAO98-311 aa

PF13454NAD_binding_9109-159 aa

PF07992Pyr_redox_2110-159 aa

PF01593Amino_oxidase120-162 aa

PF01593Amino_oxidase195-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G488480	`PF01134`	GIDA	97	167	0.11	12.3
TkA02G488480	`PF01266`	DAO	98	311	1.3e-17	65.1
TkA02G488480	`PF13454`	NAD_binding_9	109	159	0.0015	19.2
TkA02G488480	`PF07992`	Pyr_redox_2	110	159	0.037	14.2
TkA02G488480	`PF01593`	Amino_oxidase	120	162	0.1	12.6
TkA02G488480	`PF01593`	Amino_oxidase	195	229	0.1	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card