TkA02G486910 | RubberDandelionOmics

Gene overview

TkA02G486910

Reference: TK1151 Chr: Chr02 Coordinates: 124543199-124545850 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2255 bp · TkA02G486910|TK1151|cDNA

ATAGAACCTCCGTTCCCCTTCACCAAAACACACAACAACCACACCATAAAACACACACATACACTTACACGAACACACAGATATTCATTCTCCGACCTCCTCTCTTTCACTCACTTAATCATGGCCGTTGATTCAGCGACGTCCTCACCGCTAGGTCCGCCGGTGACGGAAAAAGATGCAAAGGCTCTTCAGTTTATAGAAGAGATGACAAAAAATTGTGACTCCGTTCAGGAGAACGTTCTCTGTGAAATCCTCACCCA...

CDS

Download CDS FASTA

1920 bp · TkA02G486910|TK1151|CDS

ATAGAACCTCCGTTCCCCTTCACCAAAACACACAACAACCACACCATAAAACACACACATACACTTACACGAACACACAGATATTCATTCTCCGACCTCCTCTCTTTCACTCACTTAATCATGGCCGTTGATTCAGCGACGTCCTCACCGCTAGGTCCGCCGGTGACGGAAAAAGATGCAAAGGCTCTTCAGTTTATAGAAGAGATGACAAAAAATTGTGACTCCGTTCAGGAGAACGTTCTCTGTGAAATCCTCACCCA...

Protein

Download Protein FASTA

639 aa · TkA02G486910|TK1151|PROTEIN

IEPPFPFTKTHNNHTIKHTHTLTRTHRYSFSDLLSFTHLIMAVDSATSSPLGPPVTEKDAKALQFIEEMTKNCDSVQENVLCEILTQNAATEYVQKWDLGGTTDRKTFKSKVPVVSYEDLQPYIQRIANGDRSFILSSHPISEFLTSSGTSAGERKLMPTIAEEMDRRQKLYSLLMPVMNLYVPGLDKGKGLYFLFIKAETKTPSGLVARPVLTSYYKSQQFKTRPYDPYNVYTSPNETILCVDSFQSMYSQMLCGLIYR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G486910`
TK1151 ID	TkA02G486910
OH-1004 ID	LXL04_013584
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 93.740 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G486910

Location Chr02:124543199-124545850 (-)

Description Similar to GH3.1: Probable indole-3-acetic acid-amido synthetase GH3.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g14960`	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	Characterization of an Arabidopsis enzyme family that conjugates amino acids to indole-3-acetic acid.2005 · DOI: 10.1105/tpc.104.026690
`At2g23170`	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A3BLS0`	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excessive free auxin.	No verified direct reference in this release
`Os07g0592600`	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excessive free auxin.	Activation of the indole-3-acetic acid-amido synthetase GH3-8 suppresses expansin expression and promotes salicylate- and jasmonate-independent basal immunity in rice.2008 · DOI: 10.1105/tpc.107.055657 Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility.2011 · DOI: 10.1093/pcp/pcr142
`Os01g0764800`	May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013584 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009555 pollen development Biological Process

GO:0009733 response to auxin Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0140964 intracellular auxin homeostasis Biological Process

GO:1900424 regulation of defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010279 indole-3-acetic acid amido synthetase activity Molecular Function

GO:0016208 AMP binding Molecular Function

GO:0016881 acid-amino acid ligase activity Molecular Function

KEGG gene cross-reference

ath:AT2G14960

ath:AT2G23170

dosa:Os01g0764800

dosa:Os07g0592600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.449

Rank 1 · TkA02G486910 · TK1151

Nucleus0.448

Rank 2 · TkA02G486910 · TK1151

Mitochondrion0.088

Rank 3 · TkA02G486910 · TK1151

Plastid0.049

Rank 4 · TkA02G486910 · TK1151

Peroxisome0.042

Rank 5 · TkA02G486910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23571GH3_M26-39 aa

PF03321GH363-370 aa

PF23571GH3_M398-476 aa

PF24989DUF7776479-509 aa

PF23572GH3_C492-610 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G486910	`PF23571`	GH3_M	26	39	4.8e-30	104.1
TkA02G486910	`PF03321`	GH3	63	370	5.5e-120	400.9
TkA02G486910	`PF23571`	GH3_M	398	476	4.8e-30	104.1
TkA02G486910	`PF24989`	DUF7776	479	509	0.29	12.3
TkA02G486910	`PF23572`	GH3_C	492	610	8.8e-38	130.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82333`	Arabidopsis thaliana	sp\|O82333\|GH31_ARATH Probable indole-3-acetic acid-amido synthetase GH3.1	75.000%	Swiss-Prot	High
`O22190`	Arabidopsis thaliana	sp\|O22190\|GH33_ARATH Indole-3-acetic acid-amido synthetase GH3.3	74.200%	Swiss-Prot	High
`A3BLS0`	Oryza sativa subsp. indica	sp\|A3BLS0\|GH38_ORYSI Indole-3-acetic acid-amido synthetase GH3.8	71.400%	Swiss-Prot	High
`Q0D4Z6`	Oryza sativa subsp. japonica	sp\|Q0D4Z6\|GH38_ORYSJ Indole-3-acetic acid-amido synthetase GH3.8	71.400%	Swiss-Prot	High
`P0C0M2`	Oryza sativa subsp. japonica	sp\|P0C0M2\|GH32_ORYSJ Probable indole-3-acetic acid-amido synthetase GH3.2	69.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card