TkA02G483430 | RubberDandelionOmics

Gene overview

TkA02G483430

Reference: TK1151 Chr: Chr02 Coordinates: 123375303-123377353 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1343 bp · TkA02G483430|TK1151|cDNA

TTTTAAACTCATCTTGTTACAAACTACTATTATCTTCTTTTAATTATTTATATAAAAATAATGACCTTCCACGTTTAAACATATGTTTACTGTATTTTGTTTGGACAAAAAGATAAATCAAACAAAGAGATCGGTTGCCAAGATTTGCACCGGTGTACAAACGTGGATGCAAACGTCGATAAATCAGCCACCGCGCACCAATCGTCGTATACGACGGTGCTGTCACACCGCCTCAATCCCACTGCTAGTAATTTGAACGT...

CDS

Download CDS FASTA

555 bp · TkA02G483430|TK1151|CDS

ATGGGTTTCTGGGACGCTCTTCTCAATTGGCTTCGGAGCATTTTCTTCAAGCAGGAAATGGAGCTCTCTCTGATTGGGCTCCAGAACGCTGGAAAAACCTCACTCGTAAACGTCGTTGCCACTGGTGGGTATAGCGAGGACATGATCCCTACGGTGGGATTTAATATGCGAAAGGTAACAAAAGGAAACGTGACCATTAAACTATGGGATCTTGGAGGTCAACCAAGATTTCGAAGCATGTGGGAGAGATACTGTCGTGC...

Protein

Download Protein FASTA

184 aa · TkA02G483430|TK1151|PROTEIN

MGFWDALLNWLRSIFFKQEMELSLIGLQNAGKTSLVNVVATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGQPRFRSMWERYCRAVSAIVYVVDAADHDNLSVSKSELHDLISKPGLSGIPLLVLGNKIDKAGALSKEALTDQMGLRSIGEREVCCFMISCKHSTNIDSVIDWLIKHSKSKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G483430`
TK1151 ID	TkA02G483430
OH-1004 ID	LXL04_006692
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.500
Protein coverage (%)	TK1151 99.457 / OH-1004 99.457 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G483430

Location Chr02:123375303-123377353 (-)

Description Similar to ARL8A: ADP-ribosylation factor-like protein 8a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67560`	May play a role in lysosome motility.	No verified direct reference in this release
`At3g49870`	May play a role in lysosome motility.	No verified direct reference in this release
`At5g37680`	May play a role in lysosome motility.	No verified direct reference in this release
`At3g49860`	May play a role in lysosome motility.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006692 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007059 chromosome segregation Biological Process

GO:0015031 protein transport Biological Process

GO:0051301 cell division Biological Process

GO:0051607 defense response to virus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005819 spindle Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G49860

ath:AT3G49870

ath:AT5G37680

ath:AT5G67560

gga:421175

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.423

Rank 1 · TkA02G483430 · TK1151

Golgi apparatus0.346

Rank 2 · TkA02G483430 · TK1151

Lysosome / Vacuole0.195

Rank 3 · TkA02G483430 · TK1151

Endoplasmic reticulum0.175

Rank 4 · TkA02G483430 · TK1151

Cell membrane0.166

Rank 5 · TkA02G483430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025Arf10-178 aa

PF00503G-alpha17-39 aa

PF00009GTP_EFTU20-40 aa

PF08477Roc22-132 aa

PF09439SRPRB22-144 aa

PF02421FeoB_N22-73 aa

PF00071Ras23-179 aa

PF01926MMR_HSR123-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G483430	`PF00025`	Arf	10	178	4.9e-45	153.8
TkA02G483430	`PF00503`	G-alpha	17	39	1.8e-06	28.0
TkA02G483430	`PF00009`	GTP_EFTU	20	40	6.5e-06	26.6
TkA02G483430	`PF08477`	Roc	22	132	6.2e-16	59.4
TkA02G483430	`PF09439`	SRPRB	22	144	2.1e-06	28.0
TkA02G483430	`PF02421`	FeoB_N	22	73	0.35	11.1
TkA02G483430	`PF00071`	Ras	23	179	7.4e-17	62.1
TkA02G483430	`PF01926`	MMR_HSR1	23	130	2.7e-07	31.4
TkA02G483430	`PF04670`	Gtr1_RagA	24	142	2.8e-09	37.5
TkA02G483430	`PF00350`	Dynamin_N	24	39	0.023	15.4
TkA02G483430	`PF00503`	G-alpha	49	108	1.8e-06	28.0
TkA02G483430	`PF00009`	GTP_EFTU	56	180	6.5e-06	26.6
TkA02G483430	`PF00350`	Dynamin_N	74	119	0.023	15.4
TkA02G483430	`PF16897`	MMR_HSR1_Xtn	106	174	0.012	16.3
TkA02G483430	`PF01926`	MMR_HSR1	132	177	2.7e-07	31.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y31`	Arabidopsis thaliana	sp\|Q93Y31\|ARL8B_ARATH ADP-ribosylation factor-like protein 8b	90.100%	Swiss-Prot	High
`Q8VY57`	Arabidopsis thaliana	sp\|Q8VY57\|ARL8A_ARATH ADP-ribosylation factor-like protein 8a	89.600%	Swiss-Prot	High
`Q8W4C8`	Arabidopsis thaliana	sp\|Q8W4C8\|ARL8C_ARATH ADP-ribosylation factor-like protein 8c	79.600%	Swiss-Prot	High
`F4IZ82`	Arabidopsis thaliana	sp\|F4IZ82\|ARL8D_ARATH ADP-ribosylation factor-like protein 8d	79.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card