TkA02G481330 | RubberDandelionOmics

Gene overview

TkA02G481330

Reference: TK1151 Chr: Chr02 Coordinates: 122835903-122837963 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1913 bp · TkA02G481330|TK1151|cDNA

TTTCATATCAGTTATTACGTTTTTCCTTTTAATCCATATTCGATACGACCTGGCCACGATGACAATTGGGTGTTTATCCGAGTACATACGTTGCTCAACTCTCGAACCCAACGAGGAACGGCATTGAACGGCTCCGCGTGTATCTTTTCGAGTCGGTGACGATTGTATCCTTGCCTCCTTGGCTTCTTCCCCCGTTTCCGCCATTCGCATCCCTACTTTACAGAACCACAATTCGCATACCTACTAATCCTAAAATGGCA...

CDS

Download CDS FASTA

768 bp · TkA02G481330|TK1151|CDS

ATGGCGGTGAACAACGAGATCGGAGTTATTCAACCAATGGAAGAAATCGGCCAAATATGTAAGGAATTCAACATCCCGTTCCACACAGATGCCGCACAGGCGTTAGGTAAAATTCCAGTCGACGTGAACAAGTGGAACATAAGCTTGATGTCGCTAAGCGGACATAAAGTGTATGGTCCTAAAGGCGTCGGAGCTTTGTACATGAGGCGGCGACCCCGAATTAGGGTTGAACCCCAGATGAACGGCGGTGGACAGGAAAG...

Protein

Download Protein FASTA

255 aa · TkA02G481330|TK1151|PROTEIN

MAVNNEIGVIQPMEEIGQICKEFNIPFHTDAAQALGKIPVDVNKWNISLMSLSGHKVYGPKGVGALYMRRRPRIRVEPQMNGGGQERGIRSGTVPTPLVVGMGAACELAMKEMEHDEKWVTQLKDRLLNGVRSKLDGVVVNGSTERRYAGNLNLSFAYVEGESLLMGLKEVAVSSGSACTSASLEPSYVLRALGVDEDMAHTSIRFGIGRFTTEEEIDKAVELTVNQVVKLREMSPLYEMVKEGIDIKSIQWSQH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G481330`
TK1151 ID	TkA02G481330
OH-1004 ID	LXL04_013652
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 89.020 / OH-1004 47.890 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G481330

Location Chr02:122835903-122837963 (+)

Description Similar to NIFS1: Cysteine desulfurase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65720`	Catalyzes the removal of elemental sulfur from cysteine to produce alanine.	AtSufE is an essential activator of plastidic and mitochondrial desulfurases in Arabidopsis.2006 · DOI: 10.1038/sj.emboj.7600968 Functional analysis of Arabidopsis genes involved in mitochondrial iron-sulfur cluster assembly.2007 · DOI: 10.1007/s11103-007-9147-x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013652 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006777 Mo-molybdopterin cofactor biosynthetic process Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0032324 molybdopterin cofactor biosynthetic process Biological Process

GO:0044571 [2Fe-2S] cluster assembly Biological Process

GO:0044572 [4Fe-4S] cluster assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005813 centrosome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G65720

hsa:9054

mmu:18041

pon:100174307

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.566

Rank 1 · TkA02G481330 · TK1151

Nucleus0.310

Rank 2 · TkA02G481330 · TK1151

Mitochondrion0.210

Rank 3 · TkA02G481330 · TK1151

Cell membrane0.087

Rank 4 · TkA02G481330 · TK1151

Endoplasmic reticulum0.037

Rank 5 · TkA02G481330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00266Aminotran_51-219 aa

PF01041DegT_DnrJ_EryC17-36 aa

PF00282Pyridoxal_deC11-34 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G481330	`PF00266`	Aminotran_5	1	219	1.1e-42	147.1
TkA02G481330	`PF01041`	DegT_DnrJ_EryC1	7	36	0.011	15.7
TkA02G481330	`PF00282`	Pyridoxal_deC	11	34	0.04	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49543`	Arabidopsis thaliana	sp\|O49543\|MNIF1_ARATH Cysteine desulfurase, mitochondrial	85.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card