TkA02G481140 | RubberDandelionOmics

Gene overview

TkA02G481140

Reference: TK1151 Chr: Chr02 Coordinates: 122745729-122747244 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1384 bp · TkA02G481140|TK1151|cDNA

ATTAGTGTCTCCATATAGAGGTGTAGATGTCATCTATAGACAAGTTCATGAGCGAGCGGCTTTGACTTTAGTTAAGTGGGGGGCCGCGTAAACAAAGTGGAAAACCAGGAATGGCATCATCGGAAGAACCGGATAGCAACGCCTCCATGTCCCAACCCTACAAACTAAAGCAAACCCTCACTGGCCACAAACGCTCCATTTCCAGCGTCAAATTCTCCGACGATGGCAAGCTAATCGCCACTTGTTCCGCCGACAAGACC...

CDS

Download CDS FASTA

639 bp · TkA02G481140|TK1151|CDS

ATGGCATCATCGGAAGAACCGGATAGCAACGCCTCCATGTCCCAACCCTACAAACTAAAGCAAACCCTCACTGGCCACAAACGCTCCATTTCCAGCGTCAAATTCTCCGACGATGGCAAGCTAATCGCCACTTGTTCCGCCGACAAGACCGCCCGCACATGGTCCACCTCCGATGGATCTCCTCTCCAAGAATTCGTCGGCCATGAGCAAGGAATCTCAGACGTCGCATTCTCCTCCGACGCTCGGTACCTGGCGACCGC...

Protein

Download Protein FASTA

212 aa · TkA02G481140|TK1151|PROTEIN

MASSEEPDSNASMSQPYKLKQTLTGHKRSISSVKFSDDGKLIATCSADKTARTWSTSDGSPLQEFVGHEQGISDVAFSSDARYLATASDDKTVRLWDVCTGSLVKTLTGHTNYVFCVNYNPQSNMIVSGSFDETVRVWDVKTGKCLKVLPAHSDPVTAVNFNRDGTLIVSSSYDGLCRIWDASTGHCMKTLIDDENPLLALSNFPQMENSSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G481140`
TK1151 ID	TkA02G481140
OH-1004 ID	LXL04_013656
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 31.132 / OH-1004 19.940 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G481140

Location Chr02:122745729-122747244 (-)

Description Similar to WDR5A: COMPASS-like H3K4 histone methylase component WDR5A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49660`	Forms multiple COMPASS-like complexes involved in histone methylation by interacting with different histone H3 'Lys-4' methyltransferases such as ATX1, SDG14 or SDG16.	Establishment of the winter-annual growth habit via FRIGIDA-mediated histone methylation at FLOWERING LOCUS C in Arabidopsis.2009 · DOI: 10.1105/tpc.109.067967

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013656 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0018022 peptidyl-lysine methylation Biological Process

GO:0032259 methylation Biological Process

GO:0045722 positive regulation of gluconeogenesis Biological Process

GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0051726 regulation of cell cycle Biological Process

KEGG gene cross-reference

ath:AT3G49660

bta:100125836

hsa:11091

mmu:140858

rno:362093

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.493

Rank 1 · TkA02G481140 · TK1151

Nucleus0.413

Rank 2 · TkA02G481140 · TK1151

Lysosome / Vacuole0.090

Rank 3 · TkA02G481140 · TK1151

Cell membrane0.075

Rank 4 · TkA02G481140 · TK1151

Golgi apparatus0.073

Rank 5 · TkA02G481140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23770Beta-prop_RIG_1st4-60 aa

PF17957Big_76-57 aa

PF24105Beta-prop_CAF1B_HIR110-100 aa

PF24797Beta-prop_WDR35_TULP_N11-144 aa

PF24782WD40_MABP1-WDR62_2nd13-180 aa

PF31099SHKBP1_KCTD3_C13-56 aa

PF25178Beta-prop_WDR4114-76 aa

PF16755Beta-prop_NUP159_NUP21414-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G481140	`PF23770`	Beta-prop_RIG_1st	4	60	0.00011	21.7
TkA02G481140	`PF17957`	Big_7	6	57	1.1e-05	26.7
TkA02G481140	`PF24105`	Beta-prop_CAF1B_HIR1	10	100	1.1e-25	91.2
TkA02G481140	`PF24797`	Beta-prop_WDR35_TULP_N	11	144	5.9e-08	32.9
TkA02G481140	`PF24782`	WD40_MABP1-WDR62_2nd	13	180	5.8e-22	78.8
TkA02G481140	`PF31099`	SHKBP1_KCTD3_C	13	56	4.8e-08	32.7
TkA02G481140	`PF25178`	Beta-prop_WDR41	14	76	1.3e-14	54.5
TkA02G481140	`PF16755`	Beta-prop_NUP159_NUP214	14	154	0.00011	22.3
TkA02G481140	`PF24807`	WD40_CDC20-Fz	16	70	5.1e-29	102.2
TkA02G481140	`PF23609`	Beta-prop_EIPR1	17	54	9.2e-11	42.4
TkA02G481140	`PF23756`	Beta-prop_HPS5	17	51	1e-05	25.6
TkA02G481140	`PF00400`	WD40	18	55	8.7e-53	175.2
TkA02G481140	`PF25173`	Beta-prop_WDR3_1st	18	114	1.3e-52	178.9
TkA02G481140	`PF23381`	Beta-prop_IFT122_1st	18	88	3.5e-50	171.6
TkA02G481140	`PF24817`	WD40_WDHD1_1st	18	109	1.3e-47	163.1
TkA02G481140	`PF25172`	Beta-prop_WDR3_2nd	18	139	4.8e-38	131.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2Z2`	Arabidopsis thaliana	sp\|Q9M2Z2\|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A	52.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card