TkA02G479600 | RubberDandelionOmics

Gene overview

TkA02G479600

Reference: TK1151 Chr: Chr02 Coordinates: 122373637-122375169 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1455 bp · TkA02G479600|TK1151|cDNA

ATGATTGTCGTTGAGTTTGACTCTTTTGTGAACCCAGAATGGGATCCTCCATATGAACATGTGGGTATTAATAAGAACTCGATTAGTTCAGCTAAATATACCTCTTGGAATGCTAGTTTACATAGTGGAGACCCTACTGATGTTTGGGTTGCTTACAATGGTACTACCCAGATTCTAGATTTGTCATGGAGTTACGGGGGTAGAGAGAATAGCACTACTCTTTCGTATCAAGTCGACCTCCGTGAAGTTCTTCCTGAGTG...

CDS

Download CDS FASTA

1455 bp · TkA02G479600|TK1151|CDS

ATGATTGTCGTTGAGTTTGACTCTTTTGTGAACCCAGAATGGGATCCTCCATATGAACATGTGGGTATTAATAAGAACTCGATTAGTTCAGCTAAATATACCTCTTGGAATGCTAGTTTACATAGTGGAGACCCTACTGATGTTTGGGTTGCTTACAATGGTACTACCCAGATTCTAGATTTGTCATGGAGTTACGGGGGTAGAGAGAATAGCACTACTCTTTCGTATCAAGTCGACCTCCGTGAAGTTCTTCCTGAGTG...

Protein

Download Protein FASTA

484 aa · TkA02G479600|TK1151|PROTEIN

MIVVEFDSFVNPEWDPPYEHVGINKNSISSAKYTSWNASLHSGDPTDVWVAYNGTTQILDLSWSYGGRENSTTLSYQVDLREVLPEWVTVGFSAATGANVERHILQYWEFNSSLNITKKSEDNSKEWKLAVGIIVPLGFLVLGGLVACAVFFRRKRKPNEKSMETVTLTSMNDDLERGAGPKRFSYGDLVSATNNFSRDRKLGEGGFGCVYKGYLSREGITVAVKKISQGSKQGKKEYITEVKIISSLRHRNLVQLIGWC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G479600`
TK1151 ID	TkA02G479600
OH-1004 ID	LXL04_017249
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	47.200
Protein coverage (%)	TK1151 95.041 / OH-1004 73.487 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G479600

Location Chr02:122373637-122375169 (+)

Description Similar to LECRK91: L-type lectin-domain containing receptor kinase IX.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10530`	Promotes hydrogen peroxide H(2)O(2) production and cell death.	No verified direct reference in this release
`At5g65600`	Promotes hydrogen peroxide H(2)O(2) production and cell death.	No verified direct reference in this release
`At3g55550`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release
`At5g55830`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0531400`	Lectin-domain containing receptor kinase involved in salt stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017249 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G55550

ath:AT5G06740

ath:AT5G10530

ath:AT5G55830

ath:AT5G65600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.824

Rank 1 · TkA02G479600 · TK1151

Endoplasmic reticulum0.096

Rank 2 · TkA02G479600 · TK1151

Cytoplasm0.087

Rank 3 · TkA02G479600 · TK1151

Nucleus0.044

Rank 4 · TkA02G479600 · TK1151

Lysosome / Vacuole0.040

Rank 5 · TkA02G479600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00139Lectin_legB2-123 aa

PF18483Lectin_L-type_dom4-104 aa

PF27898C3orf18_N133-160 aa

PF00069Pkinase197-283 aa

PF07714PK_Tyr_Ser-Thr198-290 aa

PF00069Pkinase296-437 aa

PF07714PK_Tyr_Ser-Thr299-375 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G479600	`PF00139`	Lectin_legB	2	123	1.2e-35	124.0
TkA02G479600	`PF18483`	Lectin_L-type_dom	4	104	0.0013	19.4
TkA02G479600	`PF27898`	C3orf18_N	133	160	0.084	13.6
TkA02G479600	`PF00069`	Pkinase	197	283	1.2e-36	127.1
TkA02G479600	`PF07714`	PK_Tyr_Ser-Thr	198	290	1.8e-35	123.2
TkA02G479600	`PF00069`	Pkinase	296	437	1.2e-36	127.1
TkA02G479600	`PF07714`	PK_Tyr_Ser-Thr	299	375	1.8e-35	123.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXA5`	Arabidopsis thaliana	sp\|Q9LXA5\|LRK91_ARATH L-type lectin-domain containing receptor kinase IX.1	53.200%	Swiss-Prot	High
`Q9LSL5`	Arabidopsis thaliana	sp\|Q9LSL5\|LRK92_ARATH L-type lectin-domain containing receptor kinase IX.2	51.300%	Swiss-Prot	High
`Q9M2S4`	Arabidopsis thaliana	sp\|Q9M2S4\|LRKS4_ARATH L-type lectin-domain containing receptor kinase S.4	36.400%	Swiss-Prot	Medium
`Q9FHG4`	Arabidopsis thaliana	sp\|Q9FHG4\|LRKS7_ARATH Probable L-type lectin-domain containing receptor kinase S.7	35.300%	Swiss-Prot	Medium
`Q7XUN6`	Oryza sativa subsp. japonica	sp\|Q7XUN6\|SIT2_ORYSJ L-type lectin-domain containing receptor kinase SIT2	37.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card