TkA02G478120 | RubberDandelionOmics

Gene overview

TkA02G478120

Reference: TK1151 Chr: Chr02 Coordinates: 122006558-122007693 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

960 bp · TkA02G478120|TK1151|cDNA

ATGGTTCACCATGCTCGAAGACTATCGCAAATATATCGATCTTCTCAGATCACTGATGGAACACATATGACGCCGGTGCAGGTGGACTCTGATTCCGATCCGGATTCCGACTCTGATGCCGAATCCGATTTGGATCCTGAGGCGGATCAGGACGACGCAACGTCGCTGCCAGGACAAGCGACATCGACGCCGGCGGTTGCAAGAGAAGAAATCCAGGCGGTGGTCACCGATCCAGACATGCTGCATTGCTCAATCTGTCA...

CDS

Download CDS FASTA

960 bp · TkA02G478120|TK1151|CDS

ATGGTTCACCATGCTCGAAGACTATCGCAAATATATCGATCTTCTCAGATCACTGATGGAACACATATGACGCCGGTGCAGGTGGACTCTGATTCCGATCCGGATTCCGACTCTGATGCCGAATCCGATTTGGATCCTGAGGCGGATCAGGACGACGCAACGTCGCTGCCAGGACAAGCGACATCGACGCCGGCGGTTGCAAGAGAAGAAATCCAGGCGGTGGTCACCGATCCAGACATGCTGCATTGCTCAATCTGTCA...

Protein

Download Protein FASTA

319 aa · TkA02G478120|TK1151|PROTEIN

MVHHARRLSQIYRSSQITDGTHMTPVQVDSDSDPDSDSDAESDLDPEADQDDATSLPGQATSTPAVAREEIQAVVTDPDMLHCSICHNSLCPPIYLCDNGHTSCTSCKTRSKNTCPSCSIPKGFNRCRGMDKLVESMKVECKYRWSGCRETLMFTKKSEHENKCRHTICFCPITFVQPSTPCNYRHTYKNVYDHFCRDHLAYSVPFVYHKELDITVEETQKRIVLREQEDGVLFILNHDNQEYGRVFNVECIGPGAFTGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G478120`
TK1151 ID	TkA02G478120
OH-1004 ID	LXL04_013692
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 83.699 / OH-1004 59.598 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G478120

Location Chr02:122006558-122007693 (+)

Description Similar to At5g37930: E3 ubiquitin-protein ligase SINA-like 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53360`	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.	SINAT5 promotes ubiquitin-related degradation of NAC1 to attenuate auxin signals.2002 · DOI: 10.1038/nature00998 SINAT E3 ligases regulate the stability of the ESCRT component FREE1 in response to iron deficiency in plants.2020 · DOI: 10.1111/jipb.13005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013692 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009411 response to UV Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G66620

ath:AT1G66630

ath:AT5G37870

ath:AT5G37890

ath:AT5G37930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.640

Rank 1 · TkA02G478120 · TK1151

Nucleus0.431

Rank 2 · TkA02G478120 · TK1151

Mitochondrion0.060

Rank 3 · TkA02G478120 · TK1151

Cell membrane0.059

Rank 4 · TkA02G478120 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA02G478120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21362Sina_RING83-118 aa

PF21361Sina_ZnF91-111 aa

PF21361Sina_ZnF132-199 aa

PF21362Sina_RING163-173 aa

PF21361Sina_ZnF271-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G478120	`PF21362`	Sina_RING	83	118	1.1e-07	32.6
TkA02G478120	`PF21361`	Sina_ZnF	91	111	2.3e-08	35.0
TkA02G478120	`PF21361`	Sina_ZnF	132	199	2.3e-08	35.0
TkA02G478120	`PF21362`	Sina_RING	163	173	1.1e-07	32.6
TkA02G478120	`PF21361`	Sina_ZnF	271	278	2.3e-08	35.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S3N1`	Arabidopsis thaliana	sp\|Q8S3N1\|SINA5_ARATH E3 ubiquitin-protein ligase SINAT5	40.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card