TkA02G477560 | RubberDandelionOmics

Gene overview

TkA02G477560

Reference: TK1151 Chr: Chr02 Coordinates: 121870251-121872219 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1643 bp · TkA02G477560|TK1151|cDNA

CAACAAACTCACATGTATTTCCACGTGGCTTTCACACCTTCCTCCCTATAAATATGTCACTTCCTAACCTTCCATGTCATCATCTATTGCATCCGCGGCGCCTCGATCGATTCTTCTCGATCTCATCTCTCTCTTTCTCAAACACCGCCATGTCAACCTCTGATCTCGCTGTCATTTTACCTCGTGTCATCATCGTATCCAGACGAAGCCTTCGCAAGAACAAGTTCGTTGATTTCGTCGGTGAATATCATCTAGATCTT...

CDS

Download CDS FASTA

1374 bp · TkA02G477560|TK1151|CDS

ATGTCACTTCCTAACCTTCCATGTCATCATCTATTGCATCCGCGGCGCCTCGATCGATTCTTCTCGATCTCATCTCTCTCTTTCTCAAACACCGCCATGTCAACCTCTGATCTCGCTGTCATTTTACCTCGTGTCATCATCGTATCCAGACGAAGCCTTCGCAAGAACAAGTTCGTTGATTTCGTCGGTGAATATCATCTAGATCTTATAGTCGGTTATGGAGCGGTTCCGGTAATTGTACCCCGCGTCGCCGGCGTCCA...

Protein

Download Protein FASTA

457 aa · TkA02G477560|TK1151|PROTEIN

MSLPNLPCHHLLHPRRLDRFFSISSLSFSNTAMSTSDLAVILPRVIIVSRRSLRKNKFVDFVGEYHLDLIVGYGAVPVIVPRVAGVHTLLHSFEPIHGVLLCEGEDIDPSLYDAEETNLSPEELEEIRRLHVSDTAIDKEKDTIELSLAKLCLERNIPYLGICRGSQILNVACGGTLYQDIGKELTKSRPQEKKVIHMDYDNYDGHRHPVEIVDDTPLHQWFEESLEDNMEIRVNSYHHQGVKRLAHRFKPMAFAPDGLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G477560`
TK1151 ID	TkA02G477560
OH-1004 ID	LXL04_013702
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G477560

Location Chr02:121870251-121872219 (-)

Description Similar to GAT1_2.1: Putative glutamine amidotransferase GAT1_2.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15040`	Putative glutamine amidotransferase that represses shoot branching.	A nitrogen-regulated glutamine amidotransferase (GAT1_2.1) represses shoot branching in Arabidopsis.2012 · DOI: 10.1104/pp.112.199364

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013702 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006598 polyamine catabolic process Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016740 transferase activity Molecular Function

GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Molecular Function

GO:0016874 ligase activity Molecular Function

GO:0033969 gamma-glutamyl-gamma-aminobutyrate hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G15040

ehr:EHR_08225

lla:L120396

rpr:RP404

spo:2541359

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.556

Rank 1 · TkA02G477560 · TK1151

Cytoplasm0.258

Rank 2 · TkA02G477560 · TK1151

Nucleus0.143

Rank 3 · TkA02G477560 · TK1151

Mitochondrion0.142

Rank 4 · TkA02G477560 · TK1151

Peroxisome0.077

Rank 5 · TkA02G477560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07722Peptidase_C2661-285 aa

PF00117GATase139-291 aa

PF20270CATRA-C212-230 aa

PF08855DUF1825332-348 aa

PF20270CATRA-C368-407 aa

PF08855DUF1825399-447 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G477560	`PF07722`	Peptidase_C26	61	285	1.7e-43	149.6
TkA02G477560	`PF00117`	GATase	139	291	3.6e-13	50.3
TkA02G477560	`PF20270`	CATRA-C	212	230	0.051	15.0
TkA02G477560	`PF08855`	DUF1825	332	348	1.6	9.4
TkA02G477560	`PF20270`	CATRA-C	368	407	0.051	15.0
TkA02G477560	`PF08855`	DUF1825	399	447	1.6	9.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0Z4`	Arabidopsis thaliana	sp\|Q8H0Z4\|GT121_ARATH Putative glutamine amidotransferase GAT1_2.1	61.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card