TkA02G477120 | RubberDandelionOmics

Gene overview

TkA02G477120

Reference: TK1151 Chr: Chr02 Coordinates: 121779161-121782798 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2984 bp · TkA02G477120|TK1151|cDNA

AAAAGTCTAAAAATAATAATGTTAGATGATGACATGTCAAGATATTTATGGAGCTTTCTTGCATTTGGATAAATTTATCTCGCCACACCGCATTTCGACTTCCAAATTCAGCTTCGAGGCAAACCTGTTCGTGTTTGAGAATGTCAGCAATGATGTTTCTCTCACCCACCATGCTCTCAGATTCTTCGAACTTCCCCAAAAAGATTTACTCGTTAAACCCTCAAAATCATCCTAATTCCCTTTCTGTTCCTACCCAAACC...

CDS

Download CDS FASTA

2271 bp · TkA02G477120|TK1151|CDS

ATGGAGCTTTCTTGCATTTGGATAAATTTATCTCGCCACACCGCATTTCGACTTCCAAATTCAGCTTCGAGGCAAACCTGTTCGTGTTTGAGAATGTCAGCAATGATGTTTCTCTCACCCACCATGCTCTCAGATTCTTCGAACTTCCCCAAAAAGATTTACTCGTTAAACCCTCAAAATCATCCTAATTCCCTTTCTGTTCCTACCCAAACCACCCCTGAAATTCGTGACACAAATAATGAATTTAAGCTAAATCCTTC...

Protein

Download Protein FASTA

756 aa · TkA02G477120|TK1151|PROTEIN

MELSCIWINLSRHTAFRLPNSASRQTCSCLRMSAMMFLSPTMLSDSSNFPKKIYSLNPQNHPNSLSVPTQTTPEIRDTNNEFKLNPSIPATKTAPWMKGPLILEPNQVIDFSKPKTRKKSSDNKKEKAEKSLTHKVSGGRGKHAMKKILYSIDTLEEETQELEDTQQNLAPIEFDLSLGKLGEDSDGGDKRWPRRKMPWEREERMVFRRTKREKTVTAADITLNEELLERLRAEARRMRKWVKVKKAGVNEGVLEQIRLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G477120`
TK1151 ID	TkA02G477120
OH-1004 ID	LXL04_013704
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G477120

Location Chr02:121779161-121782798 (+)

Description Similar to At5g16180: Chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16180`	Required for the splicing of group IIA introns in chloroplasts, by regulating the intron folding.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0360100`	Required for the splicing of group IIA introns in chloroplasts, by regulating the intron folding.	No verified direct reference in this release
`Os11g0592400`	Binds specific group II introns in chloroplasts and facilitates their splicing.	Two CRM protein subfamilies cooperate in the splicing of group IIB introns in chloroplasts.2008 · DOI: 10.1261/rna.1223708

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013704 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000373 Group II intron splicing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006417 regulation of translation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G16180

dosa:Os08g0360100

dosa:Os11g0592400

zma:100126360

zma:541870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.807

Rank 1 · TkA02G477120 · TK1151

Mitochondrion0.146

Rank 2 · TkA02G477120 · TK1151

Nucleus0.087

Rank 3 · TkA02G477120 · TK1151

Cytoplasm0.046

Rank 4 · TkA02G477120 · TK1151

Peroxisome0.012

Rank 5 · TkA02G477120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08286Spc24151-169 aa

PF08286Spc24211-240 aa

PF01985CRS1_YhbY223-306 aa

PF09087Cyc-maltodext_N322-343 aa

PF01985CRS1_YhbY400-484 aa

PF09087Cyc-maltodext_N553-600 aa

PF08286Spc24561-672 aa

PF01985CRS1_YhbY613-700 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G477120	`PF08286`	Spc24	151	169	3.8	8.5
TkA02G477120	`PF08286`	Spc24	211	240	3.8	8.5
TkA02G477120	`PF01985`	CRS1_YhbY	223	306	6.9e-51	171.2
TkA02G477120	`PF09087`	Cyc-maltodext_N	322	343	0.015	16.3
TkA02G477120	`PF01985`	CRS1_YhbY	400	484	6.9e-51	171.2
TkA02G477120	`PF09087`	Cyc-maltodext_N	553	600	0.015	16.3
TkA02G477120	`PF08286`	Spc24	561	672	3.8	8.5
TkA02G477120	`PF01985`	CRS1_YhbY	613	700	6.9e-51	171.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LF10`	Arabidopsis thaliana	sp\|Q9LF10\|CRS1_ARATH Chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic	52.900%	Swiss-Prot	High
`Q6YYA3`	Oryza sativa subsp. japonica	sp\|Q6YYA3\|CRS1_ORYSJ Chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic	45.300%	Swiss-Prot	Medium
`Q2R1U8`	Oryza sativa subsp. japonica	sp\|Q2R1U8\|CFM3_ORYSJ CRM-domain containing factor CFM3, chloroplastic/mitochondrial	39.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card