TkA02G476990 | RubberDandelionOmics

Gene overview

TkA02G476990

Reference: TK1151 Chr: Chr02 Coordinates: 121746274-121749630 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1416 bp · TkA02G476990|TK1151|cDNA

ATGGCCTGGCTTCTTCGGCTCCTTCCTCCGCCGGGTGGGGTTTTTGTCTCCCATTTTGCAGTCTCCGCTCCCACTTCAATCGGCTTCAATTCGGCTTCACTTCCTCTTTTGTGTTGGCAGCACACAGTTTTGGTATACTATTCGTTCGCTGTTTCTCTTCCACCGTTGTTTTACTCAATAATTGTGGTTCTCGATTTTCTTCCCTTTCTCTTCCCAATCAATTGCTTCACCCTATTGATTGATTACAGGGTTGGAAAGAC...

CDS

Download CDS FASTA

1416 bp · TkA02G476990|TK1151|CDS

ATGGCCTGGCTTCTTCGGCTCCTTCCTCCGCCGGGTGGGGTTTTTGTCTCCCATTTTGCAGTCTCCGCTCCCACTTCAATCGGCTTCAATTCGGCTTCACTTCCTCTTTTGTGTTGGCAGCACACAGTTTTGGTATACTATTCGTTCGCTGTTTCTCTTCCACCGTTGTTTTACTCAATAATTGTGGTTCTCGATTTTCTTCCCTTTCTCTTCCCAATCAATTGCTTCACCCTATTGATTGATTACAGGGTTGGAAAGAC...

Protein

Download Protein FASTA

471 aa · TkA02G476990|TK1151|PROTEIN

MAWLLRLLPPPGGVFVSHFAVSAPTSIGFNSASLPLLCWQHTVLVYYSFAVSLPPLFYSIIVVLDFLPFLFPINCFTLLIDYRVGKTQMVSELERAELVKCAIDRIERCRFIPTAIVPLIPLAGLAAHSLIRRTLFSICFPLLDFAIEVPGYHLIPPLRLCLGRNSFKVNAIASKSVINRLCSEFLSFKGFSTIPIPRRQVRRAKLKDQELVVKVQRPGLKVLFDIDLKNLRVIAENLQKLHPKSDGAKRDWEIDYTKEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G476990`
TK1151 ID	TkA02G476990
OH-1004 ID	LXL04_013709
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.400
Protein coverage (%)	TK1151 88.110 / OH-1004 49.029 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G476990

Location Chr02:121746274-121749630 (+)

Description Similar to RE1: Retrovirus-related Pol polyprotein from transposon RE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64940`	May participate in responses to oxidative stress, high light and heavy metals.	Loss of the Atypical Kinases ABC1K7 and ABC1K8 Changes the Lipid Composition of the Chloroplast Membrane.2015 · DOI: 10.1093/pcp/pcv046
`At3g07700`	Involved in resistance to oxidative stress.	Loss of the Atypical Kinases ABC1K7 and ABC1K8 Changes the Lipid Composition of the Chloroplast Membrane.2015 · DOI: 10.1093/pcp/pcv046
`UniProt: Q8L6Y4`	Polycomb group (PcG) protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0162100`	Polycomb group (PcG) protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013709 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0010150 leaf senescence Biological Process

GO:0015074 DNA integration Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0046467 membrane lipid biosynthetic process Biological Process

GO:0046686 response to cadmium ion Biological Process

KEGG gene cross-reference

ath:AT5G64940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.423

Rank 1 · TkA02G476990 · TK1151

Mitochondrion0.224

Rank 2 · TkA02G476990 · TK1151

Endoplasmic reticulum0.130

Rank 3 · TkA02G476990 · TK1151

Cytoplasm0.121

Rank 4 · TkA02G476990 · TK1151

Nucleus0.083

Rank 5 · TkA02G476990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109ABC1200-328 aa

PF09733VEFS-Box326-377 aa

PF05890Ebp2429-462 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G476990	`PF03109`	ABC1	200	328	5.4e-22	78.8
TkA02G476990	`PF09733`	VEFS-Box	326	377	4.5e-14	53.2
TkA02G476990	`PF05890`	Ebp2	429	462	0.51	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y08`	Arabidopsis thaliana	sp\|Q93Y08\|AB1K8_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic	68.000%	Swiss-Prot	Low
`B9DGY1`	Arabidopsis thaliana	sp\|B9DGY1\|AB1K7_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 7, chloroplastic	40.900%	Swiss-Prot	Low
`Q8L6Y4`	Arabidopsis thaliana	sp\|Q8L6Y4\|EMF2_ARATH Polycomb group protein EMBRYONIC FLOWER 2	61.800%	Swiss-Prot	Low
`Q0JF48`	Oryza sativa subsp. japonica	sp\|Q0JF48\|EMF2A_ORYSJ Polycomb group protein EMF2A	60.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card