TkA02G476300 | RubberDandelionOmics

Gene overview

TkA02G476300

Reference: TK1151 Chr: Chr02 Coordinates: 121563029-121564620 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1203 bp · TkA02G476300|TK1151|cDNA

ACCAATCTGAGTTCGACGAATTACATCAAAAGGAAGTCCAATTCCTCGTGAATCCACAAATAAAAAAGTTGTACACGCGAAAACAGAGAAGTCGTCGGAGCATCCAAAGAAATGACCGGCGCCGGTTCTTCTGGTCGTCTTCCGTCGTGGAAGGAAAGGGAGAACAATAAGAGACGAGAGAGGAGAAGAAGAGCCATCGCCGCAAAGATCTACGCTGGACTTCGATCTCAAGGGAACTACAGACTTCCTAAACACTGTGA...

CDS

Download CDS FASTA

924 bp · TkA02G476300|TK1151|CDS

ATGACCGGCGCCGGTTCTTCTGGTCGTCTTCCGTCGTGGAAGGAAAGGGAGAACAATAAGAGACGAGAGAGGAGAAGAAGAGCCATCGCCGCAAAGATCTACGCTGGACTTCGATCTCAAGGGAACTACAGACTTCCTAAACACTGTGACAATAACGAGGTCCTGAAAGCACTCTGTGCTGAAGCTGGCTGGGTCGTTGAAGAAGACGGCACCACTTACCCCAAGGGATGCAAGCCATCTCCAAATGAAATCGCAGGCAT...

Protein

Download Protein FASTA

307 aa · TkA02G476300|TK1151|PROTEIN

MTGAGSSGRLPSWKERENNKRRERRRRAIAAKIYAGLRSQGNYRLPKHCDNNEVLKALCAEAGWVVEEDGTTYPKGCKPSPNEIAGMSTNISNCSSIQPSPMSSSFPSPAPSYHASPTSSSFPSPSRCENPPQNHSSYILPYLCNLSSLPSLRISNSAPVTPPLSSPTSRGTKRKPDWEMLSATTLQSFRHPLFAASAPTSPTRRHRVPPATIPECDESDASTVDSGRWVSFQTMAAAVAAPPSPTFNLMKPSSQQAFFQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G476300`
TK1151 ID	TkA02G476300
OH-1004 ID	LXL04_008960
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	58.600
Protein coverage (%)	TK1151 91.205 / OH-1004 87.975 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G476300

Location Chr02:121563029-121564620 (-)

Description Similar to BZR1: Protein BRASSINAZOLE-RESISTANT 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36780`	BES1/BZR1 homolog protein 2.	No verified direct reference in this release
`At1g75080`	Transcriptional repressor that binds to the brassinosteroid (BR) response element (BRRE) 5'-CGTG(T/C)G-3' in gene promoter.	BR signal influences Arabidopsis ovule and seed number through regulating related genes expression by BZR1.2013 · DOI: 10.1093/mp/sss070 Histone Demethylases Coordinate the Antagonistic Interaction Between Abscisic Acid and Brassinosteroid Signaling in Arabidopsis .2020 · DOI: 10.3389/fpls.2020.596835
`At1g19350`	Positive regulator of brassinosteroid (BR) signaling.	A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis.2005 · DOI: 10.1016/j.cell.2004.11.044 Modulation of brassinosteroid-regulated gene expression by Jumonji domain-containing proteins ELF6 and REF6 in Arabidopsis.2008 · DOI: 10.1073/pnas.0802254105 Arabidopsis MYB30 is a direct target of BES1 and cooperates with BES1 to regulate brassinosteroid-induced gene expression.2009 · DOI: 10.1111/j.1365-313x.2008.03778.x Arabidopsis IWS1 interacts with transcription factor BES1 and is involved in plant steroid hormone brassinosteroid regulated gene expression.2010 · DOI: 10.1073/pnas.0909198107 Histone lysine methyltransferase SDG8 is involved in brassinosteroid-regulated gene expression in Arabidopsis thaliana.2014 · DOI: 10.1093/mp/ssu056 Regulation of plant stem cell quiescence by a brassinosteroid signaling module.2014 · DOI: 10.1016/j.devcel.2014.05.020

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8B7S5`	Positive brassinosteroid-signaling protein.	No verified direct reference in this release
`Os07g0580500`	Positive brassinosteroid-signaling protein.	Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice.2007 · DOI: 10.1073/pnas.0706386104 DWARF AND LOW-TILLERING, a new member of the GRAS family, plays positive roles in brassinosteroid signaling in rice.2009 · DOI: 10.1111/j.1365-313x.2009.03825.x Dynamics of brassinosteroid response modulated by negative regulator LIC in rice.2012 · DOI: 10.1371/journal.pgen.1002686

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008960 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009650 UV protection Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048316 seed development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0071367 cellular response to brassinosteroid stimulus Biological Process

KEGG gene cross-reference

ath:AT1G19350

ath:AT1G75080

ath:AT4G36780

dosa:Os07g0580500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.954

Rank 1 · TkA02G476300 · TK1151

Cytoplasm0.165

Rank 2 · TkA02G476300 · TK1151

Cell membrane0.023

Rank 3 · TkA02G476300 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA02G476300 · TK1151

Mitochondrion0.010

Rank 5 · TkA02G476300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05687BES1_N6-145 aa

PF05687BES1_N201-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G476300	`PF05687`	BES1_N	6	145	5.3e-64	215.8
TkA02G476300	`PF05687`	BES1_N	201	209	5.3e-64	215.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A43`	Arabidopsis thaliana	sp\|Q94A43\|BEH2_ARATH BES1/BZR1 homolog protein 2	62.500%	Swiss-Prot	High
`Q8S307`	Arabidopsis thaliana	sp\|Q8S307\|BZR1_ARATH Protein BRASSINAZOLE-RESISTANT 1	56.100%	Swiss-Prot	High
`Q9LN63`	Arabidopsis thaliana	sp\|Q9LN63\|BZR2_ARATH Protein BRASSINAZOLE-RESISTANT 2	56.900%	Swiss-Prot	High
`B8B7S5`	Oryza sativa subsp. indica	sp\|B8B7S5\|BZR1_ORYSI Protein BZR1 homolog 1	59.200%	Swiss-Prot	High
`Q7XI96`	Oryza sativa subsp. japonica	sp\|Q7XI96\|BZR1_ORYSJ Protein BZR1 homolog 1	59.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card