Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2804 bp · TkA02G474000|TK1151|cDNA
TGTCTGTTATTGAATATACAATATCAGCTCGTTCTATATAGCTCTCAAATTATTACTTTTGAAGCTCAACTCTACTTCCCATTTTATTCCAACCATCAATATGATGCATCTCACAAAACAATTTCAACATCTGAAGATACAACTGGAAGTTATAAATCTGCAACTAACAACTTTGCTGATGACAAATGCATCGGAAGAGGAGGATTCGGGAAAGTATACAAGGGAGAGCTTCTCCGTTCTGAGGGGAATATAGTTGTTGC...
2745 bp · TkA02G474000|TK1151|CDS
TGTCTGTTATTGAATATACAATATCAGCTCGTTCTATATAGCTCTCAAATTATTACTTTTGAAGCTCAACTCTACTTCCCATTTTATTCCAACCATCAATATGATGCATCTCACAAAACAATTTCAACATCTGAAGATACAACTGGAAGTTATAAATCTGCAACTAACAACTTTGCTGATGACAAATGCATCGGAAGAGGAGGATTCGGGAAAGTATACAAGGGAGAGCTTCTCCGTTCTGAGGGGAATATAGTTGTTGC...
Protein
Download Protein FASTA914 aa · TkA02G474000|TK1151|PROTEIN
CLLLNIQYQLVLYSSQIITFEAQLYFPFYSNHQYDASHKTISTSEDTTGSYKSATNNFADDKCIGRGGFGKVYKGELLRSEGNIVVAIKRLDPRFGQGNPEFWKEIVILSLYKHENIISLLGFCDESNEKILVYEYASRRSLDLYLNNTDLSWIQRLKICIGVARGLAYLHNHGISQQRVLHRDIKSSNILLDENSNAKISDLGLSKFGPGNQQYTFLVSNIVGTLGYCDPLYIETGLLTKESDVYSFGVVLFEVLCGRL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G474000 |
|---|---|
| TK1151 ID | TkA02G474000 |
| OH-1004 ID | LXL04_013748 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 71.100 |
| Protein coverage (%) | TK1151 69.475 / OH-1004 97.168Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G474000 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:120981180-120985846 (-) | ||||||||||||||||||
| Description | Similar to At1g30570: Probable receptor-like protein kinase At1g30570 | ||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0009826 unidimensional cell growth Biological Process GO:0010038 response to metal ion Biological Process GO:0010183 pollen tube guidance Biological Process GO:0010483 pollen tube reception Biological Process GO:0005576 extracellular region Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005777 peroxisome Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009506 plasmodesma Cellular Component GO:0009536 plastid Cellular Component | ||||||||||||||||||
| KEGG gene cross-reference | ath:AT1G30570 ath:AT3G20530 ath:AT3G46290 ath:AT5G39000 ath:AT5G59700 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03109ABC159-93 aaPF00069Pkinase60-327 aaPF07714PK_Tyr_Ser-Thr62-330 aaPF03109ABC1127-210 aaPF06371Drf_GBD141-157 aaPF19584MCAfunc364-491 aaPF25368PUB10_N369-452 aaPF25368PUB10_N508-532 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G474000 | PF03109 | ABC1 | 59 | 93 | 0.018 | 14.9 |
| TkA02G474000 | PF00069 | Pkinase | 60 | 327 | 9.8e-44 | 150.4 |
| TkA02G474000 | PF07714 | PK_Tyr_Ser-Thr | 62 | 330 | 9.8e-44 | 150.3 |
| TkA02G474000 | PF03109 | ABC1 | 127 | 210 | 0.018 | 14.9 |
| TkA02G474000 | PF06371 | Drf_GBD | 141 | 157 | 0.0038 | 17.5 |
| TkA02G474000 | PF19584 | MCAfunc | 364 | 491 | 0.0019 | 18.6 |
| TkA02G474000 | PF25368 | PUB10_N | 369 | 452 | 0.00064 | 21.1 |
| TkA02G474000 | PF25368 | PUB10_N | 508 | 532 | 0.00064 | 21.1 |
| TkA02G474000 | PF00069 | Pkinase | 653 | 677 | 9.8e-44 | 150.4 |
| TkA02G474000 | PF06371 | Drf_GBD | 751 | 810 | 0.0038 | 17.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9SA72 | Arabidopsis thaliana | sp|Q9SA72|Y1357_ARATH Probable receptor-like protein kinase At1g30570 | 46.100% | Swiss-Prot | Low |
Q9LX66 | Arabidopsis thaliana | sp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 1 | 43.900% | Swiss-Prot | Low |
Q9FN92 | Arabidopsis thaliana | sp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g59700 | 41.800% | Swiss-Prot | Low |
Q9FID8 | Arabidopsis thaliana | sp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g39000 | 44.300% | Swiss-Prot | Low |
Q9FID9 | Arabidopsis thaliana | sp|Q9FID9|Y5389_ARATH Probable receptor-like protein kinase At5g38990 | 43.300% | Swiss-Prot | Low |