TkA02G473780 | RubberDandelionOmics

Gene overview

TkA02G473780

Reference: TK1151 Chr: Chr02 Coordinates: 120910416-120912871 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1255 bp · TkA02G473780|TK1151|cDNA

CGAAAACAACATGAAAGAGGATTCTTCAGCCACCGTCGTCTGCGTCACCGGAGCCGCCGGATTCATCGGCTCATGGCTCGTCATGAGACTTCTAGAACGTGGGTACATTGTTCGCGCCACCGTTCGTGACCCCGATAACGTAAAGAAGGTGAAGCATCTGTTAGAACTACCAAAAGCAGAAACAAATTTGACGTTATGGAAGGCAGATTTGACACAAGAAGGAAGCTTCGATGACGCCATTGAAGGTTGCCATGGAGTCT...

CDS

Download CDS FASTA

1062 bp · TkA02G473780|TK1151|CDS

ATGAAAGAGGATTCTTCAGCCACCGTCGTCTGCGTCACCGGAGCCGCCGGATTCATCGGCTCATGGCTCGTCATGAGACTTCTAGAACGTGGGTACATTGTTCGCGCCACCGTTCGTGACCCCGATAACGTAAAGAAGGTGAAGCATCTGTTAGAACTACCAAAAGCAGAAACAAATTTGACGTTATGGAAGGCAGATTTGACACAAGAAGGAAGCTTCGATGACGCCATTGAAGGTTGCCATGGAGTCTTTCATGTCGC...

Protein

Download Protein FASTA

353 aa · TkA02G473780|TK1151|PROTEIN

MKEDSSATVVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPDNVKKVKHLLELPKAETNLTLWKADLTQEGSFDDAIEGCHGVFHVATPMDFQSSDPENEIIKPTIEGVLSIIRSCVKAKTVKKLIFTSSAGTVNVHESQLPVYDESHWSDLEFIYSKKMTAWMYFVSKTLAERAAMEETEKKNIDFISIIPTLVVGPFITPSFPPSLITALSLINGEESHYSIIKQGQYVHLDDLCESHIYLYENPEAKGRYICSSHDA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G473780`
TK1151 ID	TkA02G473780
OH-1004 ID	LXL04_013757
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G473780`
Location	Chr02:120910416-120912871 (+)
Description	Similar to F: Dihydroflavonol 4-reductase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013757` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process GO:0045552 dihydroflavanol 4-reductase activity Molecular Function GO:0047890 flavanone 4-reductase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.740

Rank 1 · TkA02G473780 · TK1151

Nucleus0.224

Rank 2 · TkA02G473780 · TK1151

Endoplasmic reticulum0.089

Rank 3 · TkA02G473780 · TK1151

Cell membrane0.065

Rank 4 · TkA02G473780 · TK1151

Lysosome / Vacuole0.059

Rank 5 · TkA02G473780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05368NmrA9-146 aa

PF00106adh_short9-80 aa

PF01370Epimerase10-250 aa

PF02719Polysacc_synt_210-135 aa

PF08659KR10-140 aa

PF010733Beta_HSD12-180 aa

PF16363GDP_Man_Dehyd12-268 aa

PF07993NAD_binding_412-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G473780	`PF05368`	NmrA	9	146	2.1e-12	48.0
TkA02G473780	`PF00106`	adh_short	9	80	6.4e-06	26.5
TkA02G473780	`PF01370`	Epimerase	10	250	1.4e-25	90.9
TkA02G473780	`PF02719`	Polysacc_synt_2	10	135	0.00054	19.9
TkA02G473780	`PF08659`	KR	10	140	0.00055	20.6
TkA02G473780	`PF01073`	3Beta_HSD	12	180	2.1e-18	67.1
TkA02G473780	`PF16363`	GDP_Man_Dehyd	12	268	4.6e-15	56.6
TkA02G473780	`PF07993`	NAD_binding_4	12	197	8.3e-12	45.5
TkA02G473780	`PF13460`	NAD_binding_10	14	149	6.5e-13	49.7
TkA02G473780	`PF24840`	NTF2_SigF	181	239	0.082	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card