TkA02G471070 | RubberDandelionOmics

Gene overview

TkA02G471070

Reference: TK1151 Chr: Chr02 Coordinates: 120181457-120185096 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2404 bp · TkA02G471070|TK1151|cDNA

ATTAACTCATTTTCTCAATCAAAACGGTGGATCACGAGTCTCGGCCAACGAGTTGAAAATTCAGAAAACCAGGGAAGATCAAACCGATCAGTGTACAAACTCCCGACCATATCAGCCGAGCCGACACACTCAAGTTTGATAAATTATTCAAGTTCCGGCGTCAAAATGCCATCGACGTTAACCCAGACTCAGAGATATGCCGCCGGAGCTTTGTTCGGCCTGGCCCTAAACCAGACACAGATTCACCAAACCTTTCCGTT...

CDS

Download CDS FASTA

1152 bp · TkA02G471070|TK1151|CDS

ATGGCTGTATTGAAAGAAGAAGAAGCAAAGGAAGAAGATCAAGCACCAAAAAGCGTGTGGGCTAAATGGAGACGTGGAGGTATCATTGGAGCTGCTGCTTTAACTGGTGGAACTTTAATGGCAATTACTGGTGGTTTAGCTGCTCCCGCAATTGCTGCAGGATTTAGTGCATTGGCACCTACATTAGGCACAATTATACCAGTGATTGGAGCTGGTGGTTTTGCTGCTGTTGCCACAGCTGCAGGAAGTGTTGCAGGTTC...

Protein

Download Protein FASTA

383 aa · TkA02G471070|TK1151|PROTEIN

MAVLKEEEAKEEDQAPKSVWAKWRRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTIIPVIGAGGFAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRTGSIDEFEFKTIGDNHNQGRLAVEILVSGFVFEEQDFIRPWEDQLNNMERYALQWESKHLIAVSTAIQDWLSSSLAMELMRQGAMMTVLSSLLAALAWPATLLTLTSFIDSKWTIAVNRSDKAGTLLAEVLIKGLQGNRPVTLIGFSLGAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G471070`
TK1151 ID	TkA02G471070
OH-1004 ID	LXL04_013803
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.200
Protein coverage (%)	TK1151 100.000 / OH-1004 55.635 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G471070

Location Chr02:120181457-120185096 (+)

Description Similar to Tmco4: Transmembrane and coiled-coil domain-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0112800`	Involved in anther lipids biosynthesis and is required for tapetum degradation and pollen wall formation.	SWOLLEN TAPETUM AND STERILITY 1 is required for tapetum degeneration and pollen wall formation in rice.2022 · DOI: 10.1093/plphys/kiac307 OsLDDT1, encoding a transmembrane structural DUF726 family protein, is essential for tapetum degradation and pollen formation in rice.2023 · DOI: 10.1016/j.plantsci.2023.111596

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013803 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010208 pollen wall assembly Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0052689 carboxylic ester hydrolase activity Molecular Function

KEGG gene cross-reference

cel:CELE_F35D11.3

dosa:Os03g0112800

hsa:255104

mmu:77056

rno:500573

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.686

Rank 1 · TkA02G471070 · TK1151

Cytoplasm0.179

Rank 2 · TkA02G471070 · TK1151

Cell membrane0.094

Rank 3 · TkA02G471070 · TK1151

Endoplasmic reticulum0.076

Rank 4 · TkA02G471070 · TK1151

Nucleus0.074

Rank 5 · TkA02G471070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05277DUF72622-369 aa

PF12697Abhydrolase_672-163 aa

PF08237PE-PPE110-129 aa

PF02450LCAT155-196 aa

PF08237PE-PPE204-274 aa

PF12697Abhydrolase_6236-292 aa

PF02450LCAT245-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G471070	`PF05277`	DUF726	22	369	1.6e-101	340.4
TkA02G471070	`PF12697`	Abhydrolase_6	72	163	0.21	12.9
TkA02G471070	`PF08237`	PE-PPE	110	129	0.14	12.3
TkA02G471070	`PF02450`	LCAT	155	196	0.16	11.9
TkA02G471070	`PF08237`	PE-PPE	204	274	0.14	12.3
TkA02G471070	`PF12697`	Abhydrolase_6	236	292	0.21	12.9
TkA02G471070	`PF02450`	LCAT	245	288	0.16	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q10SS2`	Oryza sativa subsp. japonica	sp\|Q10SS2\|STS1_ORYSJ Transmembrane and coiled-coil domain-containing protein STS1	76.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card