TkA02G468840 | RubberDandelionOmics

Gene overview

TkA02G468840

Reference: TK1151 Chr: Chr02 Coordinates: 119572831-119581334 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4383 bp · TkA02G468840|TK1151|cDNA

ATGGCTGGAGATAAGGGTGACAAAGGCGATGGTAGTGTATCAAAACACGACACCATCGACTTTGATGATCCACTCTACATCCATCCATCTGATAATTCCATAAACACCATCACCACTGTTAAACTTACCGGTCCTGAGAACTATCGCCTCTGGCGTAGCTCTATAATGAGAAGCCTAACTGCACGCAATAAACTCTGCTTCATAGATGAAACTCTTAAAAAACCTACTGATAATCCAATTAAATCTTCAAAATGGGAACG...

CDS

Download CDS FASTA

4383 bp · TkA02G468840|TK1151|CDS

ATGGCTGGAGATAAGGGTGACAAAGGCGATGGTAGTGTATCAAAACACGACACCATCGACTTTGATGATCCACTCTACATCCATCCATCTGATAATTCCATAAACACCATCACCACTGTTAAACTTACCGGTCCTGAGAACTATCGCCTCTGGCGTAGCTCTATAATGAGAAGCCTAACTGCACGCAATAAACTCTGCTTCATAGATGAAACTCTTAAAAAACCTACTGATAATCCAATTAAATCTTCAAAATGGGAACG...

Protein

Download Protein FASTA

1460 aa · TkA02G468840|TK1151|PROTEIN

MAGDKGDKGDGSVSKHDTIDFDDPLYIHPSDNSINTITTVKLTGPENYRLWRSSIMRSLTARNKLCFIDETLKKPTDNPIKSSKWERANAVVSSWILSSISESIQAGHVYSEIASNIWDELYETYNKSDGSVIFNIHQKINSLTQKGSSLSEYYNKMDSLWKEFDDLVYITSCICEASTKLNDHAKLMKLMQFLNGLDDSYHQESLQKGGSMSSSPSKTGPSAFASKFNNKINTNTNTNTSNSNYKGRNPNNSICKHCNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G468840`
TK1151 ID	TkA02G468840
OH-1004 ID	LXL04_016743
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	37.000
Protein coverage (%)	TK1151 76.164 / OH-1004 93.770 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G468840

Location Chr02:119572831-119581334 (-)

Description Similar to RE1: Retrovirus-related Pol polyprotein from transposon RE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g05710`	Catalyzes the isomerization of citrate to isocitrate via cis- aconitate.	Selective induction and subcellular distribution of ACONITASE 3 reveal the importance of cytosolic citrate metabolism during lipid mobilization in Arabidopsis.2014 · DOI: 10.1042/bj20140430
`At4g35830`	Catalyzes the isomerization of citrate to isocitrate via cis-aconitate.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0191100`	Catalyzes the isomerization of citrate to isocitrate via cis-aconitate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016743 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.674

Rank 1 · TkA02G468840 · TK1151

Nucleus0.321

Rank 2 · TkA02G468840 · TK1151

Mitochondrion0.078

Rank 3 · TkA02G468840 · TK1151

Peroxisome0.062

Rank 4 · TkA02G468840 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA02G468840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14244Retrotran_gag_328-76 aa

PF14223Retrotran_gag_259-165 aa

PF00330Aconitase166-192 aa

PF22936Pol_BBD365-429 aa

PF25597SH3_retrovirus526-585 aa

PF07727RVT_2770-945 aa

PF00330Aconitase1127-1376 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G468840	`PF14244`	Retrotran_gag_3	28	76	3.6e-11	43.4
TkA02G468840	`PF14223`	Retrotran_gag_2	59	165	4.8e-05	23.9
TkA02G468840	`PF00330`	Aconitase	166	192	4.1e-76	257.5
TkA02G468840	`PF22936`	Pol_BBD	365	429	1.7e-06	29.0
TkA02G468840	`PF25597`	SH3_retrovirus	526	585	1.1e-18	67.5
TkA02G468840	`PF07727`	RVT_2	770	945	1.9e-55	188.8
TkA02G468840	`PF00330`	Aconitase	1127	1376	4.1e-76	257.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIB9`	Arabidopsis thaliana	sp\|Q9SIB9\|ACO3M_ARATH Aconitate hydratase 3, mitochondrial	67.600%	Swiss-Prot	Low
`Q42560`	Arabidopsis thaliana	sp\|Q42560\|ACO1_ARATH Aconitate hydratase 1	68.400%	Swiss-Prot	Low
`Q6YZX6`	Oryza sativa subsp. japonica	sp\|Q6YZX6\|ACOHC_ORYSJ Putative aconitate hydratase, cytoplasmic	66.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card