Gene Card
Gene overview
cDNA / CDS / Protein Sequences
732 bp · TkA02G468320|TK1151|cDNA
TGCTCGCCATCTAGAAATAGTTTGCGTCGATTTTACTCGATTATTTAGGGTTTAAAAACAAACGCCAAGAAGATGTTTTCAAAAGATTTCTATCCCCCCACAAATTTTCTCCTCGCGCCTCTCTCTTCTCCCCCAAATTAGTTCTAATTTTCTAGAAAACCCCATAAGAATCTGGAGACGAATCCAATCTGTGTCTTCGTCTTTGTTCAATTTGCACCGCATCCTTTTTTAGCGTGCAATTGACGCCCAGAGTTTCAAAT...
456 bp · TkA02G468320|TK1151|CDS
ATGAAGAAGGGAGCTAAGAGAAAAGCTGCTGCGGCGAGCCGTAAGGATGAATTAGCTTCTACTTCTACAGAACCCGCTGCCGCCGCCACCACCACCACCGAAGCACCGGAGGAGCAACATAACAAGGAACACATAAAAGTCGGTCGACCAACAAAACGTTCGAAAGTTCCGAAGCCTGAATCTGAACCCGAGTACTTCGAGGATCAGCGTGAATTGGAGGACTTATGGAAGCAGGTCTTTCCTGTTGGGACAGAGTGGGA...
Protein
Download Protein FASTA151 aa · TkA02G468320|TK1151|PROTEIN
MKKGAKRKAAAASRKDELASTSTEPAAAATTTTEAPEEQHNKEHIKVGRPTKRSKVPKPESEPEYFEDQRELEDLWKQVFPVGTEWDQLDLLSEYKWNFSNLENAFDEGGVLHGKKVYLFSCTEPQLLFWWSIKSNMCTCSGGDCISISTF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G468320 |
|---|---|
| TK1151 ID | TkA02G468320 |
| OH-1004 ID | LXL04_007460 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 86.400 |
| Protein coverage (%) | TK1151 86.093 / OH-1004 38.992Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G468320 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr02:119447280-119448749 (-) | ||||||
| Description | Similar to HIT4: Protein HEAT INTOLERANT 4 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0009408 response to heat Biological Process GO:0010286 heat acclimation Biological Process GO:0031452 negative regulation of heterochromatin formation Biological Process GO:0045814 negative regulation of gene expression, epigenetic Biological Process GO:1900034 regulation of cellular response to heat Biological Process GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0010369 chromocenter Cellular Component | ||||||
| KEGG gene cross-reference | ath:AT5G10010 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
A2RVJ8 | Arabidopsis thaliana | sp|A2RVJ8|HIT4_ARATH Protein HEAT INTOLERANT 4 | 67.600% | Swiss-Prot | Low |