TkA02G467510 | RubberDandelionOmics

Gene overview

TkA02G467510

Reference: TK1151 Chr: Chr02 Coordinates: 119242103-119245415 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2711 bp · TkA02G467510|TK1151|cDNA

CAAACGTTGTCTTAATGAAAATTCTCTCTCAAAACATACACACACAATACGATAACACTATTAACGGAAAAATGGCAAATTTGTAGGATGATCCCTCTCGCCCTTCACTTCCATTCAAATTCCTCTTCAACAAAATCTGCAAACCGTTTCCTCTTCGTTTCTTCATCTTTTCAGCGAGAAAAAAAGGTAAACAAAAGCTTCGATCTTGCCATCATGGACGATACAACAGAATTATGTCCTGAAAACGATACGATGAACCC...

CDS

Download CDS FASTA

2460 bp · TkA02G467510|TK1151|CDS

ATGATCCCTCTCGCCCTTCACTTCCATTCAAATTCCTCTTCAACAAAATCTGCAAACCGTTTCCTCTTCGTTTCTTCATCTTTTCAGCGAGAAAAAAAGGTAAACAAAAGCTTCGATCTTGCCATCATGGACGATACAACAGAATTATGTCCTGAAAACGATACGATGAACCCAGCCTTGACGATGACCACACAGGTCTCCGCCATTTTGGTTCTCTCTCATGTTTTTCAGATTTTCCTCAAACCCTTGGGCCAACCTGC...

Protein

Download Protein FASTA

819 aa · TkA02G467510|TK1151|PROTEIN

MIPLALHFHSNSSSTKSANRFLFVSSSFQREKKVNKSFDLAIMDDTTELCPENDTMNPALTMTTQVSAILVLSHVFQIFLKPLGQPAPLAQILAGFVLGPSGLSRSPAIHVFFFQNFAVDFYESMALYCRISIMFLMGLEMDIPYLMRNLRPASIIACCGCLTCTIFAAAISFFVYEETGSRGSRFTLALVITVILASTASPIVFRLAADLKFATSDIGRLAISASLIGDMYAVFILVIISGEKHKRTVNGWALMAFCSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G467510`
TK1151 ID	TkA02G467510
OH-1004 ID	LXL04_013856
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.872 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G467510

Location Chr02:119242103-119245415 (+)

Description Similar to CHX1: Cation/H(+) antiporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16380`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At1g79400`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At2g13620`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At5g41610`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At3g17630`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013856 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006623 protein targeting to vacuole Biological Process

GO:0006813 potassium ion transport Biological Process

GO:0006885 regulation of pH Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005770 late endosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G16380

ath:AT1G79400

ath:AT2G13620

ath:AT4G23700

ath:AT5G41610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.716

Rank 1 · TkA02G467510 · TK1151

Endoplasmic reticulum0.138

Rank 2 · TkA02G467510 · TK1151

Lysosome / Vacuole0.094

Rank 3 · TkA02G467510 · TK1151

Cytoplasm0.075

Rank 4 · TkA02G467510 · TK1151

Golgi apparatus0.044

Rank 5 · TkA02G467510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00999Na_H_Exchanger72-456 aa

PF23600CdpA_N165-205 aa

PF08592Anthrone_oxy166-195 aa

PF08592Anthrone_oxy225-280 aa

PF23600CdpA_N242-292 aa

PF28423Epiregulin_C252-284 aa

PF08592Anthrone_oxy308-347 aa

PF23256CHX17_2nd512-641 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G467510	`PF00999`	Na_H_Exchanger	72	456	4.7e-43	148.2
TkA02G467510	`PF23600`	CdpA_N	165	205	0.088	13.1
TkA02G467510	`PF08592`	Anthrone_oxy	166	195	6.9	7.6
TkA02G467510	`PF08592`	Anthrone_oxy	225	280	6.9	7.6
TkA02G467510	`PF23600`	CdpA_N	242	292	0.088	13.1
TkA02G467510	`PF28423`	Epiregulin_C	252	284	0.16	12.5
TkA02G467510	`PF08592`	Anthrone_oxy	308	347	6.9	7.6
TkA02G467510	`PF23256`	CHX17_2nd	512	641	1.4e-33	116.4
TkA02G467510	`PF00582`	Usp	548	635	0.0035	18.6
TkA02G467510	`PF23259`	CHX17_C	656	816	2.1e-34	119.5
TkA02G467510	`PF00582`	Usp	664	737	0.0035	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA37`	Arabidopsis thaliana	sp\|Q9SA37\|CHX1_ARATH Cation/H(+) antiporter 1	38.600%	Swiss-Prot	Medium
`Q9SAK8`	Arabidopsis thaliana	sp\|Q9SAK8\|CHX2_ARATH Cation/H(+) antiporter 2	38.400%	Swiss-Prot	Medium
`Q9SIT5`	Arabidopsis thaliana	sp\|Q9SIT5\|CHX15_ARATH Cation/H(+) antiporter 15	30.600%	Swiss-Prot	Medium
`Q9FFR9`	Arabidopsis thaliana	sp\|Q9FFR9\|CHX18_ARATH Cation/H(+) antiporter 18	28.800%	Swiss-Prot	Low
`Q9LUN4`	Arabidopsis thaliana	sp\|Q9LUN4\|CHX19_ARATH Cation/H(+) antiporter 19	29.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card