TkA02G466880 | RubberDandelionOmics

Gene overview

TkA02G466880

Reference: TK1151 Chr: Chr02 Coordinates: 119081784-119083833 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1789 bp · TkA02G466880|TK1151|cDNA

AAAGCATCTAATAACATAATATTTCCTCAAAAGCCATAGAACGGAAAGAAAAGCTGCGATGGGTTATCTCTCAAAAGGCCCGTTAATGGCAGAGCGTTAAGAAGAAGCTAAAAATTACCTTCACTTCACGAGCTACGAACACAGTAAAAGAATTTTTGCACAGATCTCCAGAAACACACATATATATACTTCTTAAAATGGCTCAAAGAGCAGTTCCAATCGTAAAGAAACTCCTCTCCGGTACCCCACCACACGTCCGA...

CDS

Download CDS FASTA

1152 bp · TkA02G466880|TK1151|CDS

ATGGCTCAAAGAGCAGTTCCAATCGTAAAGAAACTCCTCTCCGGTACCCCACCACACGTCCGATCATGTCTACGCTCTATCACCTACATGCCACGACCCGGACGCGGCGGTACGATACCCGTCAACCCCATCACCGGAGAAGGTATTCCAAGACCCGTTACTCTAATCCCTGGCGATGGGATCGGCCCATTGGTGACCGGCGCCGTCGAACAGGTCTTTGAGGCAATGCGAGCGCCGGTTATCTTCGAGAAATTCGAAGT...

Protein

Download Protein FASTA

383 aa · TkA02G466880|TK1151|PROTEIN

MAQRAVPIVKKLLSGTPPHVRSCLRSITYMPRPGRGGTIPVNPITGEGIPRPVTLIPGDGIGPLVTGAVEQVFEAMRAPVIFEKFEVRGDMNIVPEDAMASIKKNRVCLKGGLITPVGGGVNSLNLLLRKELDLYVSLVNCFNLPGLPSRHENVNIVVIRENTEGEYSGLEHEVVPGVVESLKVITKFCSERIAQYAFEYAHLNNRKTVTAVHKANIMKLADGLFLESCREIAKRYPNINYNEIIVDNCCMQLVSKPEQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G466880`
TK1151 ID	TkA02G466880
OH-1004 ID	LXL04_013871
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 89.906 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G466880

Location Chr02:119081784-119083833 (+)

Description Similar to IDH3: Isocitrate dehydrogenase [NAD] regulatory subunit 3, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35650`	Performs an essential role in the oxidative function of the citric acid cycle.	No verified direct reference in this release
`At4g35260`	Performs an essential role in the oxidative function of the citric acid cycle.	No verified direct reference in this release
`At2g17130`	Performs an essential role in the oxidative function of the citric acid cycle.	No verified direct reference in this release
`At5g03290`	Performs an essential role in the oxidative function of the citric acid cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013871 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006102 isocitrate metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0004449 isocitrate dehydrogenase (NAD+) activity Molecular Function

KEGG gene cross-reference

ath:AT2G17130

ath:AT4G35260

ath:AT4G35650

ddi:DDB_G0293872

spo:2541894

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.916

Rank 1 · TkA02G466880 · TK1151

Cytoplasm0.086

Rank 2 · TkA02G466880 · TK1151

Nucleus0.053

Rank 3 · TkA02G466880 · TK1151

Cell membrane0.035

Rank 4 · TkA02G466880 · TK1151

Plastid0.030

Rank 5 · TkA02G466880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00180Iso_dh53-375 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G466880	`PF00180`	Iso_dh	53	375	3.9e-79	267.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81796`	Arabidopsis thaliana	sp\|O81796\|IDH3_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 3, mitochondrial	75.300%	Swiss-Prot	High
`Q8LFC0`	Arabidopsis thaliana	sp\|Q8LFC0\|IDH1_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial	78.100%	Swiss-Prot	High
`P93032`	Arabidopsis thaliana	sp\|P93032\|IDH2_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 2, mitochondrial	78.400%	Swiss-Prot	High
`Q945K7`	Arabidopsis thaliana	sp\|Q945K7\|IDH5_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial	48.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card