TkA02G465940 | RubberDandelionOmics

Gene overview

TkA02G465940

Reference: TK1151 Chr: Chr02 Coordinates: 118787685-118789627 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1245 bp · TkA02G465940|TK1151|cDNA

AAAAGACGGTCCCTTTCGGAGCAAAACTAAAACGACCCAAAACTTATAGCCTCATCGAAGCAAAGGGGAAAAATCGTTATACATCGTATCTCTCTAACCCTAGTTAGGGTTTTCATCGTCTTCATCTGCCAATTAAGTTCGACTAATTTTCTATCCCTCTGTTATTCAGTTCGAGCTTTGTGTCAGAATCATTAGGGAGACATGTACGGATCCAGGGGGGCAATGTATGGGAGCGGGGGGGTATCAAATGGGTACGAGAT...

CDS

Download CDS FASTA

858 bp · TkA02G465940|TK1151|CDS

ATGTACGGATCCAGGGGGGCAATGTATGGGAGCGGGGGGGTATCAAATGGGTACGAGATCGGCTCAAAAAGACCAAGAATGATGGACTCCAATCCCTACTTCGCAGTTTCCAGCTCAACCGCCGCCTACCACCACCACCACCACCACGCATACGACTACACCGCCGCCACCTTCCACCCCTCAACTTTCCCGGTGGTCCGCCTGCGAGGCCTCCCATTCAACTGCACCGACACCGACATCTTCAAGTTCTTCTCCGGCCT...

Protein

Download Protein FASTA

285 aa · TkA02G465940|TK1151|PROTEIN

MYGSRGAMYGSGGVSNGYEIGSKRPRMMDSNPYFAVSSSTAAYHHHHHHAYDYTAATFHPSTFPVVRLRGLPFNCTDTDIFKFFSGLEILDVLLVNKSGRFSGEAFVVFTRPMQAELALQKDHQNMGRRYVEVFKCKKQDYYNAVAGEVRYDHNNNNNNSNSNNSNNNNDYYYCYNGGSPTRSKRFQDKDQMEYTEILKLRGLPFSVKKLEIFEFFKEFKVVEGKVFIACRPDGKATGEAYVEFETVEEAKEAMVKDKKM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G465940`
TK1151 ID	TkA02G465940
OH-1004 ID	LXL04_013895
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.600
Protein coverage (%)	TK1151 97.895 / OH-1004 59.955 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G465940`
Location	Chr02:118787685-118789627 (-)
Description	Similar to Hnrnph2: Heterogeneous nuclear ribonucleoprotein H2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013895` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0043484 regulation of RNA splicing Biological Process GO:0005654 nucleoplasm Cellular Component GO:1990904 ribonucleoprotein complex Cellular Component GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	pon:100172043 rno:308650 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.913

Rank 1 · TkA02G465940 · TK1151

Cytoplasm0.194

Rank 2 · TkA02G465940 · TK1151

Cell membrane0.037

Rank 3 · TkA02G465940 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA02G465940 · TK1151

Mitochondrion0.012

Rank 5 · TkA02G465940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28442DUF840063-85 aa

PF28441RRM_1166-147 aa

PF00076RRM_167-129 aa

PF22575Vir1p151-171 aa

PF22038PRC2_EED_ins152-169 aa

PF28442DUF8400197-260 aa

PF28441RRM_11199-277 aa

PF00076RRM_1200-266 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G465940	`PF28442`	DUF8400	63	85	8e-08	33.2
TkA02G465940	`PF28441`	RRM_11	66	147	3.7e-38	130.5
TkA02G465940	`PF00076`	RRM_1	67	129	5.5e-20	71.7
TkA02G465940	`PF22575`	Vir1p	151	171	0.37	9.2
TkA02G465940	`PF22038`	PRC2_EED_ins	152	169	4.8	7.9
TkA02G465940	`PF28442`	DUF8400	197	260	8e-08	33.2
TkA02G465940	`PF28441`	RRM_11	199	277	3.7e-38	130.5
TkA02G465940	`PF00076`	RRM_1	200	266	5.5e-20	71.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card