TkA02G465750 | RubberDandelionOmics

Gene overview

TkA02G465750

Reference: TK1151 Chr: Chr02 Coordinates: 118728631-118729956 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · TkA02G465750|TK1151|cDNA

ATGAAGTGCTTACCGATGATGGCAGAAGGATTAAGATGGAGCGGTTTGGAGAAATTGGTGAGCGAGGCGGTGGTTGCAGAGAAGACGCCGCTCGTACAGAAATCAGAAGAGGAGATGGGTATCGTGAGCACCGTCATGGGGGCATTTGGGTTTGGAATTGGAGTTCCAACTGGGCTTGTGATTGGGTACTACTTCTTCATTTACTACCAAGCAACTCATGTTGAGGGATTGGGGAAAACAATATCTGCAATCGCTCTTAT...

CDS

Download CDS FASTA

426 bp · TkA02G465750|TK1151|CDS

ATGAAGTGCTTACCGATGATGGCAGAAGGATTAAGATGGAGCGGTTTGGAGAAATTGGTGAGCGAGGCGGTGGTTGCAGAGAAGACGCCGCTCGTACAGAAATCAGAAGAGGAGATGGGTATCGTGAGCACCGTCATGGGGGCATTTGGGTTTGGAATTGGAGTTCCAACTGGGCTTGTGATTGGGTACTACTTCTTCATTTACTACCAAGCAACTCATGTTGAGGGATTGGGGAAAACAATATCTGCAATCGCTCTTAT...

Protein

Download Protein FASTA

141 aa · TkA02G465750|TK1151|PROTEIN

MKCLPMMAEGLRWSGLEKLVSEAVVAEKTPLVQKSEEEMGIVSTVMGAFGFGIGVPTGLVIGYYFFIYYQATHVEGLGKTISAIALILKEQSPASSTVNCKKTNQNQTETLNLDEEEDVTSDTLVAAGTLNQPSACEIEMV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G465750`
TK1151 ID	TkA02G465750
OH-1004 ID	LXL04_027212
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.300
Protein coverage (%)	TK1151 39.716 / OH-1004 6.155 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G465750`
Location	Chr02:118728631-118729956 (+)
Description	Similar to CHR28: Helicase-like transcription factor CHR28
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027212` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006281 DNA repair Biological Process GO:0006325 chromatin organization Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0009294 DNA-mediated transformation Biological Process GO:0036297 interstrand cross-link repair Biological Process GO:0045003 double-strand break repair via synthesis-dependent strand annealing Biological Process GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	ath:AT1G50410 ath:AT3G20010 ath:AT5G22750 ath:AT5G43530 spo:2542440 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.238

Rank 1 · TkA02G465750 · TK1151

Endoplasmic reticulum0.236

Rank 2 · TkA02G465750 · TK1151

Cytoplasm0.224

Rank 3 · TkA02G465750 · TK1151

Cell membrane0.196

Rank 4 · TkA02G465750 · TK1151

Mitochondrion0.180

Rank 5 · TkA02G465750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26768YtrI_N53-109 aa

PF28153VraH53-66 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G465750	`PF26768`	YtrI_N	53	109	0.0041	17.7
TkA02G465750	`PF28153`	VraH	53	66	0.64	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card