TkA02G465670 | RubberDandelionOmics

Gene overview

TkA02G465670

Reference: TK1151 Chr: Chr02 Coordinates: 118688632-118694929 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3833 bp · TkA02G465670|TK1151|cDNA

GCCCGAGTGACGTGTGAGGGCTTGGCCAGCAGCCTTGGCGCAAGCCTAAGGTGCGGTGTTGGCGCCCCTTGGTGAGGCCATATCAACACAAGATCGTATATCACCGACGTCAAGGCTCTTGAAACCGTAAACCGCTTCCATTTCCTCGGCCCACACTGTACTCGTCCGCCTTTGCCGCCCCACACAATCGCCGCCACACCACCACTGTCGTTCTACAAGGACTTCTACTCCAGTTCTTTCTCCACACCATTTATACGATC...

CDS

Download CDS FASTA

2214 bp · TkA02G465670|TK1151|CDS

ATGAGGAGCATCAAGGTATTGCCAGAATCTGTTAGAAGTTCATTGCGTTCTGGCATCATTTTGTCAGACCTGACAAGGGTAGTAGAAGAGCTGGTGTTTAACAGCCTTGATGCTGGTGCCACAAAGGTGATTGTAGCTGTAGGTGTTGGGACCAACTACATTAAAGTTACAGACAATGGTTGTGGTATTACACGGGATGGATTGGTGTTAGTAGGAGAAAGATACGCAACTTGTAAGTTTGAGCAGCTGAAGAGTGTTCC...

Protein

Download Protein FASTA

737 aa · TkA02G465670|TK1151|PROTEIN

MRSIKVLPESVRSSLRSGIILSDLTRVVEELVFNSLDAGATKVIVAVGVGTNYIKVTDNGCGITRDGLVLVGERYATCKFEQLKSVPESFGFRGEALSSISDVSLLQVVTKAHGMPNGYCKVIKCSKCLYLGIDDDRQDVGTTVVVRDLFYNQPVRRRHLQSSPKKVLHSVKECILRIALVHLGTCFKVIDIESGDELLSLYPSSSPLPLLVSSFGTEVSSSLHELNVSDGDGKLKLSGFISGPCETFSVKAFQYFYINS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G465670`
TK1151 ID	TkA02G465670
OH-1004 ID	LXL04_013901
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.700
Protein coverage (%)	TK1151 99.050 / OH-1004 71.928 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G465670

Location Chr02:118688632-118694929 (+)

Description Similar to MLH3: DNA mismatch repair protein MLH3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35520`	Involved in DNA mismatch repair (MMR), correcting insertion-deletion loops (IDLs) resulting from DNA replication, DNA damage or from recombination events between non-identical sequences during meiosis.	Reduced meiotic crossovers and delayed prophase I progression in AtMLH3-deficient Arabidopsis.2006 · DOI: 10.1038/sj.emboj.7600992 Control of meiotic recombination in Arabidopsis: role of the MutL and MutS homologues.2006 · DOI: 10.1042/bst0340542

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013901 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006298 mismatch repair Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0000795 synaptonemal complex Cellular Component

GO:0001673 male germ cell nucleus Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005712 chiasma Cellular Component

GO:0032300 mismatch repair complex Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0003696 satellite DNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT4G35520

hsa:27030

sus:Acid_7040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.936

Rank 1 · TkA02G465670 · TK1151

Cytoplasm0.150

Rank 2 · TkA02G465670 · TK1151

Cell membrane0.022

Rank 3 · TkA02G465670 · TK1151

Mitochondrion0.021

Rank 4 · TkA02G465670 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA02G465670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02518HATPase_c23-82 aa

PF13589HATPase_c_325-116 aa

PF01119DNA_mis_repair214-342 aa

PF05906DUF865310-324 aa

PF05906DUF865678-693 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G465670	`PF02518`	HATPase_c	23	82	9.3e-07	30.0
TkA02G465670	`PF13589`	HATPase_c_3	25	116	2.5e-07	31.5
TkA02G465670	`PF01119`	DNA_mis_repair	214	342	2.7e-10	40.6
TkA02G465670	`PF05906`	DUF865	310	324	0.085	13.4
TkA02G465670	`PF05906`	DUF865	678	693	0.085	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JN26`	Arabidopsis thaliana	sp\|F4JN26\|MLH3_ARATH DNA mismatch repair protein MLH3	50.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card