TkA02G462630 | RubberDandelionOmics

Gene overview

TkA02G462630

Reference: TK1151 Chr: Chr02 Coordinates: 117864236-117866503 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1329 bp · TkA02G462630|TK1151|cDNA

CTTTACTCCGACACCCCCGTCTCAAATACTTGCCAATCCCCACCGGCGCTCGTTCCTGGTTCGGTCTCAGCTACTCGCGAATCTCCACTGCACCGCCTGGTATTTCGTTGCTGATTCAAGTTCGAAGTTCTCTTCCTCTGCACCACCGCGTCTACGTGGCCACGCATCTTCTTCCTCTACACACCTCCGCTCTAACAGGCGCCGATTTCTGTTCCCGTATTTCCGGTAAGACGATTCCGCCACTGCTCACACGCGTCGAT...

CDS

Download CDS FASTA

933 bp · TkA02G462630|TK1151|CDS

ATGGCAAAAGACCAAAACTCAAAATTCCAAAACCCAATCCTAAACAAATTAGATTCCAAATTGGGCGGATTACTCTCAGAAGTATCCAGTGAGGAAGATTTCACAGGAAAAGCCGGACAGTCAACTGTTATCAGACTCACGGGCCTTGGATCCAAACGGGTCAGCCTAATTGGGCTTGGAAAGGGGCCAACAGGCCCATCTTACCGCAGTCTTGGTGAGTCAGTTGCATCAGTTGCAAAGACATCTCAAGCCAACAATGT...

Protein

Download Protein FASTA

311 aa · TkA02G462630|TK1151|PROTEIN

MAKDQNSKFQNPILNKLDSKLGGLLSEVSSEEDFTGKAGQSTVIRLTGLGSKRVSLIGLGKGPTGPSYRSLGESVASVAKTSQANNVAIVLASSEGLTPDSRLATASHIAKGTLLGTYEDNRFKSESKKASLKSIDLFGLGSRPDLEKKLKYTQDICSGVILGKELVNAPANVLTPGVLAEEAEKIVAAYPDVLTAKILDTEQCKELKMGSYLGVAAASTNPPKFIHLCYKPLIGSVKTKLALVGKGLTFDSGGYNIKTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G462630`
TK1151 ID	TkA02G462630
OH-1004 ID	LXL04_002813
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.600
Protein coverage (%)	TK1151 94.855 / OH-1004 50.600 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G462630

Location Chr02:117864236-117866503 (-)

Description Similar to LAP2: Leucine aminopeptidase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30920`	Presumably involved in the processing and regular turnover of intracellular proteins.	Plant leucine aminopeptidases moonlight as molecular chaperones to alleviate stress-induced damage.2012 · DOI: 10.1074/jbc.m111.309500
`At2g24200`	Presumably involved in the processing and regular turnover of intracellular proteins.	No verified direct reference in this release
`At4g30910`	Presumably involved in the processing and regular turnover of intracellular proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0794700`	Presumably involved in the processing and regular turnover of intracellular proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002813 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009611 response to wounding Biological Process

GO:0010150 leaf senescence Biological Process

GO:0034214 protein hexamerization Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0043171 peptide catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT2G24200

ath:AT4G30910

ath:AT4G30920

dosa:Os02g0794700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.443

Rank 1 · TkA02G462630 · TK1151

Mitochondrion0.170

Rank 2 · TkA02G462630 · TK1151

Peroxisome0.153

Rank 3 · TkA02G462630 · TK1151

Nucleus0.122

Rank 4 · TkA02G462630 · TK1151

Extracellular0.095

Rank 5 · TkA02G462630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02789Peptidase_M17_N14-126 aa

PF00883Peptidase_M17163-290 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G462630	`PF02789`	Peptidase_M17_N	14	126	2.2e-24	86.5
TkA02G462630	`PF00883`	Peptidase_M17	163	290	3.7e-36	125.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944P7`	Arabidopsis thaliana	sp\|Q944P7\|AMPL2_ARATH Leucine aminopeptidase 2, chloroplastic	73.300%	Swiss-Prot	High
`P30184`	Arabidopsis thaliana	sp\|P30184\|AMPL1_ARATH Leucine aminopeptidase 1	68.900%	Swiss-Prot	High
`Q8RX72`	Arabidopsis thaliana	sp\|Q8RX72\|AMPL3_ARATH Leucine aminopeptidase 3, chloroplastic	68.900%	Swiss-Prot	High
`Q6K669`	Oryza sativa subsp. japonica	sp\|Q6K669\|AMPL2_ORYSJ Leucine aminopeptidase 2, chloroplastic	68.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card