RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G459850
Reference: TK1151 Chr: Chr02 Coordinates: 117130223-117133823 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2209 bp · TkA02G459850|TK1151|cDNA

TTTCTCTTTAGTCCTCTAATTCATCATCTTAAGCTTCAAGTTTTTCTTTACATTCCAACTACAGATTTTGTTTAAGAGGATATTAGATATATATGGCCTTGTGATCCAGAGACTATATACACAAAATTAAAGTAACTTTCTGTACGTGTTCCAATGGGGAAAAGAACTCCACACCGGCTGCCATGGTGGATGTCAAGTATGGTGGTTTTGATGTTTATAAAGATGATCAGTAAGCAGGTGGTTTCACAGTCAAGTGATCA...

CDS

Download CDS FASTA

1896 bp · TkA02G459850|TK1151|CDS

ATGGGGAAAAGAACTCCACACCGGCTGCCATGGTGGATGTCAAGTATGGTGGTTTTGATGTTTATAAAGATGATCAGTAAGCAGGTGGTTTCACAGTCAAGTGATCATAGGAACTACACTCTGATTAGAAACTTTTGTAGACCATATAACGTTTGGAATGGGGATGACTACCTATCTAATCTCAATAGCAGCCTTTCTAGCCTCCGAATTCAGTTATCTGATCCACAAGTATACACGGCTTTTGCACATGCCGCCAGTAA...

Protein

Download Protein FASTA

631 aa · TkA02G459850|TK1151|PROTEIN

MGKRTPHRLPWWMSSMVVLMFIKMISKQVVSQSSDHRNYTLIRNFCRPYNVWNGDDYLSNLNSSLSSLRIQLSDPQVYTAFAHAASNSEYVYSFALCMEYLSTSECLACFDTAVIQTKSCGMADGGHVVYDNCSIRYEKSDELLLNDDASPFGVCGNEAATEPTQSFVQNIEELLSDILVATPKTSTFYVASTRQVSTDNTTVYAIAQCVTQISHNICQTCLNRAYKSLHDCLPNTEGTVTDALCFVRYSETPFFHNNQT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G459850
TK1151 IDTkA02G459850
OH-1004 IDLXL04_013972
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)95.300
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G459850
LocationChr02:117130223-117133823 (+)
DescriptionSimilar to CRK42: Cysteine-rich receptor-like protein kinase 42
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g40380 Cysteine-rich receptor-like protein kinase 42. No verified direct reference in this release
At1g70530 Cysteine-rich receptor-like protein kinase 3. No verified direct reference in this release
At1g70520 Cysteine-rich receptor-like protein kinase 2. No verified direct reference in this release
At1g56130 Probable LRR receptor-like serine/threonine-protein kinase At1g56130. No verified direct reference in this release
At1g19090 Cysteine-rich receptor-like protein kinase 1. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_013972 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0007165 signal transduction Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0010193 response to ozone Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0052545 callose localization Biological Process
GO:0072593 reactive oxygen species metabolic process Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G70520
ath:AT1G70530
ath:AT4G28670
ath:AT5G40380
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.888
Rank 1 · TkA02G459850 · TK1151
Endoplasmic reticulum0.074
Rank 2 · TkA02G459850 · TK1151
Cytoplasm0.073
Rank 3 · TkA02G459850 · TK1151
Nucleus0.038
Rank 4 · TkA02G459850 · TK1151
Lysosome / Vacuole0.024
Rank 5 · TkA02G459850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657Stress-antifung52-139 aa
PF07714PK_Tyr_Ser-Thr88-106 aa
PF14634zf-RING_5106-133 aa
PF01657Stress-antifung155-251 aa
PF14634zf-RING_5209-226 aa
PF15345TMEM51271-315 aa
PF12669FeoB_associated285-307 aa
PF00069Pkinase332-546 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G459850PF01657Stress-antifung521391e-2694.2
TkA02G459850PF07714PK_Tyr_Ser-Thr881062.1e-45155.7
TkA02G459850PF14634zf-RING_51061334.68.0
TkA02G459850PF01657Stress-antifung1552511e-2694.2
TkA02G459850PF14634zf-RING_52092264.68.0
TkA02G459850PF15345TMEM512713150.0514.1
TkA02G459850PF12669FeoB_associated2853070.001519.6
TkA02G459850PF00069Pkinase3325463.4e-46158.5
TkA02G459850PF03109ABC13343630.03114.2
TkA02G459850PF07714PK_Tyr_Ser-Thr3355992.1e-45155.7
TkA02G459850PF12330Haspin_kinase4254870.06413.0
TkA02G459850PF01636APH4404780.3811.2
TkA02G459850PF03109ABC14444830.03114.2
TkA02G459850PF17667Pkinase_fungal4485040.0003220.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FNE1Arabidopsis thalianasp|Q9FNE1|CRK42_ARATH Cysteine-rich receptor-like protein kinase 4234.900%Swiss-ProtMedium
Q9CAL2Arabidopsis thalianasp|Q9CAL2|CRK3_ARATH Cysteine-rich receptor-like protein kinase 337.200%Swiss-ProtMedium
Q9CAL3Arabidopsis thalianasp|Q9CAL3|CRK2_ARATH Cysteine-rich receptor-like protein kinase 232.200%Swiss-ProtMedium
C0LGH2Arabidopsis thalianasp|C0LGH2|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g5613046.500%Swiss-ProtMedium
Q9LMB9Arabidopsis thalianasp|Q9LMB9|CRK1_ARATH Cysteine-rich receptor-like protein kinase 135.200%Swiss-ProtMedium

JBrowse

View in Genome Browser