TkA02G457790 | RubberDandelionOmics

Gene overview

TkA02G457790

Reference: TK1151 Chr: Chr02 Coordinates: 116643558-116646380 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1109 bp · TkA02G457790|TK1151|cDNA

CCGGAAAAGGGTTGTGGAAAGGCACAAAAACCCTTTTTATCGGAGAAGGTGTATAAATATGGACACCAGATTCTATTCATCCCCAAAATCCCCTCTCCATTCAAGGAATAATTTCCTCCCACGCCTTCTTCATCTTTCCACAGCATTTCCGGCAACCGTCTCCTCTGCCGCCGTGGCCACCACCGCGCAAATATGGACCACGCTCCTAAATAAACTTATTCCTTTAATGTTTGAAGATTCTGATAGTTCCAGATTATAAA...

CDS

Download CDS FASTA

810 bp · TkA02G457790|TK1151|CDS

ATGAACGACGAAGCCCCCAAAAATGAAAAGGTTATAGAGATCGAAGATGGTGATGATCACGAGGACCAATCGTCTCCGAGAGGTGTGTTGGAAATCCCCGTATCAGGTTCGGATTCCGATAATCAGAGCAGCCTAAGCAGGAGCCTCAGCAGCCGCGGTTCGTCTTTCAATGATAAATCTCCGGATGGAGAAGTTGATTCGGCTACCGAGGAGGAAGGCAGCGGCGGAGCGGAGGTTGTCAACTCTTCGGCGACGGCTCA...

Protein

Download Protein FASTA

269 aa · TkA02G457790|TK1151|PROTEIN

MNDEAPKNEKVIEIEDGDDHEDQSSPRGVLEIPVSGSDSDNQSSLSRSLSSRGSSFNDKSPDGEVDSATEEEGSGGAEVVNSSATAHGLQWRNLVDNLKWKSIKRLSALPLMAGYELSRKSLMKRLGKNQSIEDTIEGGNWAVPKPSWRNFTLEELATATDNFSSGNLVGRGGHADVYKGLLPDGQLVAVKRITKKEKKDEDRVGDFLSELGIIAHINHPNAARLIGFSSDTDLHLVLQFAPHGSLATLLHVHFRLSLQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G457790`
TK1151 ID	TkA02G457790
OH-1004 ID	LXL04_014016
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 92.193 / OH-1004 51.452 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G457790

Location Chr02:116643558-116646380 (-)

Description Similar to RBK1: Receptor-like cytosolic serine/threonine-protein kinase RBK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10520`	Receptor-like cytosolic serine/threonine-protein kinase RBK1.	No verified direct reference in this release
`At3g05140`	Receptor-like cytosolic serine/threonine-protein kinase RBK2.	No verified direct reference in this release
`At5g57670`	Probable receptor-like serine/threonine-protein kinase At5g57670.	No verified direct reference in this release
`At1g16130`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g79670`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	RESISTANCE TO FUSARIUM OXYSPORUM 1, a dominant Arabidopsis disease-resistance gene, is not race specific.2005 · DOI: 10.1534/genetics.105.042218

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014016 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0048364 root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G52290

ath:AT2G18470

ath:AT3G05140

ath:AT5G10520

ath:AT5G57670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.604

Rank 1 · TkA02G457790 · TK1151

Nucleus0.245

Rank 2 · TkA02G457790 · TK1151

Cytoplasm0.220

Rank 3 · TkA02G457790 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA02G457790 · TK1151

Plastid0.041

Rank 5 · TkA02G457790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase165-263 aa

PF07714PK_Tyr_Ser-Thr167-253 aa

PF12349Sterol-sensing189-266 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G457790	`PF00069`	Pkinase	165	263	5.3e-12	46.4
TkA02G457790	`PF07714`	PK_Tyr_Ser-Thr	167	253	2.6e-10	40.8
TkA02G457790	`PF12349`	Sterol-sensing	189	266	0.11	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1D6`	Arabidopsis thaliana	sp\|Q8H1D6\|RBK1_ARATH Receptor-like cytosolic serine/threonine-protein kinase RBK1	54.800%	Swiss-Prot	Medium
`Q8RXC8`	Arabidopsis thaliana	sp\|Q8RXC8\|RBK2_ARATH Receptor-like cytosolic serine/threonine-protein kinase RBK2	41.500%	Swiss-Prot	Medium
`Q5XF57`	Arabidopsis thaliana	sp\|Q5XF57\|Y5576_ARATH Probable receptor-like serine/threonine-protein kinase At5g57670	44.300%	Swiss-Prot	Low
`Q7X8C5`	Arabidopsis thaliana	sp\|Q7X8C5\|WAKLB_ARATH Wall-associated receptor kinase-like 2	45.200%	Swiss-Prot	Low
`Q8RY17`	Arabidopsis thaliana	sp\|Q8RY17\|WAKLI_ARATH Wall-associated receptor kinase-like 22	41.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card