TkA02G455250 | RubberDandelionOmics

Gene overview

TkA02G455250

Reference: TK1151 Chr: Chr02 Coordinates: 115927162-115930306 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2589 bp · TkA02G455250|TK1151|cDNA

ATGACTTCAAGTTTTAAGCATTAAATGATTCATATCAACGATCAATCTTCTTTACCCAAGATTTGTCGTCTAATCCTGATCCGGGCCCATTGTTTATTCTGAAAATCGAATTCCATGGAGAATATGGGAAGAGCATTCCCACCATCATCACCAAACGACCCACAAGAAAAACACATCCCAGCAACTACCACTCCTTTGACGTGTACCAGCCGTCATTGCCGGAAAGAGTCAGGGGGGAAAGGAACTTCCGCTACTGCTAC...

CDS

Download CDS FASTA

2439 bp · TkA02G455250|TK1151|CDS

ATGGAGAATATGGGAAGAGCATTCCCACCATCATCACCAAACGACCCACAAGAAAAACACATCCCAGCAACTACCACTCCTTTGACGTGTACCAGCCGTCATTGCCGGAAAGAGTCAGGGGGGAAAGGAACTTCCGCTACTGCTACTGCCACCGCCGGCTTTGAAAATGATCCTGACATGGTTTGGAAGGTTGGCGGCTATGATTTCTCAAATGATGGGCTTAAATACGATTCTCCGACATTTCGAGAACCATCGCCCAT...

Protein

Download Protein FASTA

812 aa · TkA02G455250|TK1151|PROTEIN

MENMGRAFPPSSPNDPQEKHIPATTTPLTCTSRHCRKESGGKGTSATATATAGFENDPDMVWKVGGYDFSNDGLKYDSPTFREPSPITESRKIPKKPRASFNDEVMRTPNRPPTPNRRRSTGTASGCRGEEVLVCSSNAHAALNRTSSLMKGKTTKSRMMDQPEMIRTPKSGTNQGRSRAESEIGEDDFRLNDDDSPDENKNLRYSKWNLFQLTSLILIIGVLACTFAIPRFRNKSLYDLEWWKWEVMIFVVICGKLVIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G455250`
TK1151 ID	TkA02G455250
OH-1004 ID	LXL04_014027
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G455250

Location Chr02:115927162-115930306 (-)

Description Similar to MSL8: Mechanosensitive ion channel protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78610`	Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.	No verified direct reference in this release
`At2g17010`	Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.	No verified direct reference in this release
`At3g14810`	Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.	No verified direct reference in this release
`At1g53470`	Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.	No verified direct reference in this release
`At2g17000`	Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014027 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006820 monoatomic anion transport Biological Process

GO:0009846 pollen germination Biological Process

GO:0009859 pollen hydration Biological Process

GO:0050982 detection of mechanical stimulus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0008381 mechanosensitive monoatomic ion channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G53470

ath:AT1G78610

ath:AT2G17000

ath:AT2G17010

ath:AT3G14810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.845

Rank 1 · TkA02G455250 · TK1151

Endoplasmic reticulum0.094

Rank 2 · TkA02G455250 · TK1151

Cytoplasm0.078

Rank 3 · TkA02G455250 · TK1151

Lysosome / Vacuole0.038

Rank 4 · TkA02G455250 · TK1151

Nucleus0.035

Rank 5 · TkA02G455250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25886Msy1215-353 aa

PF25886Msy1572-601 aa

PF00924MS_channel_2nd629-687 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G455250	`PF25886`	Msy1	215	353	0.0024	18.5
TkA02G455250	`PF25886`	Msy1	572	601	0.0024	18.5
TkA02G455250	`PF00924`	MS_channel_2nd	629	687	3.5e-11	43.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYM1`	Arabidopsis thaliana	sp\|Q9SYM1\|MSL6_ARATH Mechanosensitive ion channel protein 6	53.400%	Swiss-Prot	High
`F4IME2`	Arabidopsis thaliana	sp\|F4IME2\|MSL8_ARATH Mechanosensitive ion channel protein 8	53.200%	Swiss-Prot	High
`Q9LH74`	Arabidopsis thaliana	sp\|Q9LH74\|MSL5_ARATH Mechanosensitive ion channel protein 5	55.700%	Swiss-Prot	High
`Q9LPG3`	Arabidopsis thaliana	sp\|Q9LPG3\|MSL4_ARATH Mechanosensitive ion channel protein 4	50.400%	Swiss-Prot	High
`F4IME1`	Arabidopsis thaliana	sp\|F4IME1\|MSL7_ARATH Mechanosensitive ion channel protein 7	50.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card