TkA02G452080 | RubberDandelionOmics

Gene overview

TkA02G452080

Reference: TK1151 Chr: Chr02 Coordinates: 115064501-115067995 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2506 bp · TkA02G452080|TK1151|cDNA

TATAATAGCATCTGACAGTTAAAACAATCTTTTACGCATCGTATCCATAGACCTCCGTTTCCTCCTTTCTTTCCCCCATCTCCTCCTTCATACATTACTCCAAGTAGTGCAATTGACTGTTATTTTCTCGATCCTCCCCCGGCAACAATGGTGAAAGTGGCAGCGAATAAGCAAAAGGCGGCCACAAAACCATACAACGCCAACAAGAAGAAGTTCGTAAAGACAAAGAAGAAGAAAAATGTTGCCGAAAAATCAATCAT...

CDS

Download CDS FASTA

1278 bp · TkA02G452080|TK1151|CDS

ATGGTGAAAGTGGCAGCGAATAAGCAAAAGGCGGCCACAAAACCATACAACGCCAACAAGAAGAAGTTCGTAAAGACAAAGAAGAAGAAAAATGTTGCCGAAAAATCAATCATCCCAAATACATCAGCTAATCAAGCTGCCGAGACCTCTTCGGATTCTGATGCGGAGGAGAACACACCTGAACAGATTCAGAAGCTGATCGAACCGTACACTAAAGACCAGTTAATCGAAATTGTCATCAACGCCGCCATAGCAAACCC...

Protein

Download Protein FASTA

425 aa · TkA02G452080|TK1151|PROTEIN

MVKVAANKQKAATKPYNANKKKFVKTKKKKNVAEKSIIPNTSANQAAETSSDSDAEENTPEQIQKLIEPYTKDQLIEIVINAAIANPSLYARIRDAADSDVSHRKIFVYGLGWDTTKETLTLAFKPYGEIEDCNVVIDRVTGKAKGFGFVQFKSRKAAMKALKEPKKKINNRMASCQLASLGSAIAGSTENTNRKIYVSNVQPDTDAERLRAFFSKFGEIETGPLGFNSSTGKSRGFALFVYKTQEGFRKALEEPYKVFE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G452080`
TK1151 ID	TkA02G452080
OH-1004 ID	LXL04_012285
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	52.900
Protein coverage (%)	TK1151 50.118 / OH-1004 40.325 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G452080

Location Chr02:115064501-115067995 (-)

Description Similar to UBA2B: UBP1-associated protein 2B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56860`	Heterogeneous nuclear ribonucleoprotein (hnRNP)-like protein that acts as a component of a complex regulating the turnover of mRNAs in the nucleus.	UBA1 and UBA2, two proteins that interact with UBP1, a multifunctional effector of pre-mRNA maturation in plants.2002 · DOI: 10.1128/mcb.22.12.4346-4357.2002
`At2g41060`	Heterogeneous nuclear ribonucleoprotein (hnRNP)-like protein that acts as a component of a complex regulating the turnover of mRNAs in the nucleus.	No verified direct reference in this release
`At3g15010`	Heterogeneous nuclear ribonucleoprotein (hnRNP)-like protein that acts as a component of a complex regulating the turnover of mRNAs in the nucleus.	No verified direct reference in this release
`At2g22090`	Acts as a component of a complex regulating the turnover of mRNAs in the nucleus.	UBA1 and UBA2, two proteins that interact with UBP1, a multifunctional effector of pre-mRNA maturation in plants.2002 · DOI: 10.1128/mcb.22.12.4346-4357.2002

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0265800`	RNA-binding protein that binds to a cis-localization element or zipcode, within the 5'-CDS of prolamine RNA.	Characterization of RNA binding protein RBP-P reveals a possible role in rice glutelin gene expression and RNA localization.2014 · DOI: 10.1007/s11103-014-0191-z RNA-Binding Protein RBP-P Is Required for Glutelin and Prolamine mRNA Localization in Rice Endosperm Cells.2018 · DOI: 10.1105/tpc.18.00321 Zipcode RNA-Binding Proteins and Membrane Trafficking Proteins Cooperate to Transport Glutelin mRNAs in Rice Endosperm.2020 · DOI: 10.1105/tpc.20.00111

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012285 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009693 ethylene biosynthetic process Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010150 leaf senescence Biological Process

GO:0012501 programmed cell death Biological Process

GO:0048255 mRNA stabilization Biological Process

GO:0051028 mRNA transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0035925 mRNA 3'-UTR AU-rich region binding Molecular Function

KEGG gene cross-reference

ath:AT2G22090

ath:AT2G41060

ath:AT3G15010

ath:AT3G56860

dosa:Os01g0265800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.881

Rank 1 · TkA02G452080 · TK1151

Cytoplasm0.186

Rank 2 · TkA02G452080 · TK1151

Cell membrane0.030

Rank 3 · TkA02G452080 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA02G452080 · TK1151

Mitochondrion0.016

Rank 5 · TkA02G452080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24842UFD1_N219-37 aa

PF16367RRM_7104-169 aa

PF00076RRM_1106-172 aa

PF28441RRM_11109-173 aa

PF14605Nup35_RRM_2124-162 aa

PF28694SCO2_C129-157 aa

PF24842UFD1_N2149-205 aa

PF16367RRM_7194-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G452080	`PF24842`	UFD1_N2	19	37	0.19	12.5
TkA02G452080	`PF16367`	RRM_7	104	169	7.1e-08	33.0
TkA02G452080	`PF00076`	RRM_1	106	172	2.3e-31	108.2
TkA02G452080	`PF28441`	RRM_11	109	173	0.076	14.1
TkA02G452080	`PF14605`	Nup35_RRM_2	124	162	0.0019	18.7
TkA02G452080	`PF28694`	SCO2_C	129	157	0.31	11.8
TkA02G452080	`PF24842`	UFD1_N2	149	205	0.19	12.5
TkA02G452080	`PF16367`	RRM_7	194	254	7.1e-08	33.0
TkA02G452080	`PF00076`	RRM_1	196	265	2.3e-31	108.2
TkA02G452080	`PF14605`	Nup35_RRM_2	196	222	0.0019	18.7
TkA02G452080	`PF09200`	Monellin	238	258	0.19	12.3
TkA02G452080	`PF28694`	SCO2_C	385	398	0.31	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LES2`	Arabidopsis thaliana	sp\|Q9LES2\|UBA2A_ARATH UBP1-associated protein 2A	51.000%	Swiss-Prot	Medium
`O80678`	Arabidopsis thaliana	sp\|O80678\|UBA2B_ARATH UBP1-associated protein 2B	44.700%	Swiss-Prot	Medium
`Q9LKA4`	Arabidopsis thaliana	sp\|Q9LKA4\|UBA2C_ARATH UBP1-associated protein 2C	47.700%	Swiss-Prot	Medium
`Q9SHZ6`	Arabidopsis thaliana	sp\|Q9SHZ6\|UBA1A_ARATH UBP1-associated proteins 1A	60.900%	Swiss-Prot	Low
`Q9LJ04`	Oryza sativa subsp. japonica	sp\|Q9LJ04\|RBPP_ORYSJ RNA-binding protein P	50.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card