TkA02G451870 | RubberDandelionOmics

Gene overview

TkA02G451870

Reference: TK1151 Chr: Chr02 Coordinates: 114981642-114984958 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2805 bp · TkA02G451870|TK1151|cDNA

AGGGATGGAGTGACTGACTGGAGTGCTTTGCATCCCGTGCCAAAACGTAGACGCAAAAACCCTAATTATATCGATAGACGACCACTTCCGTCTTACCCTATTCTTCTCCCTTCCATTAGGAGAACGAACAAACGCCATTAGAGCTACTTCTTATGATCAACATTTCTCCAAATACGAATTCAAAAATCGTGTTTTTGTTTTCAAAAGATTTCGTCGTTTTTATTTCCAAACAATTTCTTTGTTTTCAGGGACTTGAGAAA...

CDS

Download CDS FASTA

1920 bp · TkA02G451870|TK1151|CDS

ATGGGAGAAAAATCTGATAGTAAAAAGGTGTCTTCACCATACATTGTCCTTGAAAACCGACCCCTTGATCAATGGAAAGTAACCGAATTGAAAGAGGAACTCAAGAAACGGAAATTAATGACAAGTGGTTTGAAAGAAGTACTGGTTAAAAGGCTGGATGAAGCTGTTCGTACTGAAATAAACGATGCTAAGAAAAATCTTGATGATGACCTAAACAATGAGGCTCCCTCTGATGATGTGACAGCTGTCCCAGCTGTTGT...

Protein

Download Protein FASTA

639 aa · TkA02G451870|TK1151|PROTEIN

MGEKSDSKKVSSPYIVLENRPLDQWKVTELKEELKKRKLMTSGLKEVLVKRLDEAVRTEINDAKKNLDDDLNNEAPSDDVTAVPAVVEDPIPSNPLDNKGLEKDINDKDGNEGLVKDNMELDKEKDGNSNVEKEMDDMVKTDDVIMSTQVESVQVVQEISVKTTVITTDEFSGQESQVVGNNGDSKPEKEEADVSNQVNEVSQAIPDSNSTDTISNTEKNEPKDNVITDDVKSEVDVKPESSKPEQVDTDDVIPPDDVKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G451870`
TK1151 ID	TkA02G451870
OH-1004 ID	LXL04_014120
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 88.873 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G451870`
Location	Chr02:114981642-114984958 (-)
Description	Similar to ACIN1: Apoptotic chromatin condensation inducer in the nucleus
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014120` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0048025 negative regulation of mRNA splicing, via spliceosome Biological Process GO:0050684 regulation of mRNA processing Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016607 nuclear speck Cellular Component GO:0061574 ASAP complex Cellular Component GO:0003676 nucleic acid binding Molecular Function
KEGG gene cross-reference	hsa:22985 mmu:56215 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.952

Rank 1 · TkA02G451870 · TK1151

Cytoplasm0.144

Rank 2 · TkA02G451870 · TK1151

Cell membrane0.019

Rank 3 · TkA02G451870 · TK1151

Mitochondrion0.017

Rank 4 · TkA02G451870 · TK1151

Golgi apparatus0.009

Rank 5 · TkA02G451870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02037SAP22-57 aa

PF16294RSB_motif124-137 aa

PF16294RSB_motif212-212 aa

PF16294RSB_motif354-354 aa

PF28976RRM_ACIN1448-522 aa

PF16294RSB_motif600-636 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G451870	`PF02037`	SAP	22	57	6.1e-10	39.2
TkA02G451870	`PF16294`	RSB_motif	124	137	1.6e-13	51.5
TkA02G451870	`PF16294`	RSB_motif	212	212	1.6e-13	51.5
TkA02G451870	`PF16294`	RSB_motif	354	354	1.6e-13	51.5
TkA02G451870	`PF28976`	RRM_ACIN1	448	522	2.2e-31	108.5
TkA02G451870	`PF16294`	RSB_motif	600	636	1.6e-13	51.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card