TkA02G451830 | RubberDandelionOmics

Gene overview

TkA02G451830

Reference: TK1151 Chr: Chr02 Coordinates: 114956120-114965287 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1461 bp · TkA02G451830|TK1151|cDNA

AAAAACTACATCTGAACCAATGTAGGTTTATGAGGCACCAAGAGAATCAGGGCCAAGATTGTATAGGTGTAACCCCACAACATTAGTTGACCAAAAGCATATTACTATTTGCAATAGTTCGGTGACCAAGTTTAATTTTTTGTGAGCATCAATCGACGAAGAGTGCTCCATGATCCAAATTCATGGTTTGATGCCAATGTTGAACCCTATGCAGACACCCCCGTTCATCTCCTTCATCACCACTGTGTTCTAAGACAAAT...

CDS

Download CDS FASTA

969 bp · TkA02G451830|TK1151|CDS

ATGGCTGATCGCGACGATCCCTCTCCTTTGGTTGCACCTTCTCTGATCACTGAACCGATGGAGATCGACTTAGAAGCCGGTCCCGGGGAACAAATTCAGTGCCGAATTTGTCTCGAAACTGACGGCAGAGATTTTATAGCACCCTGCAAGTGCAGAGGGACATCAAAGTATGTTCACAGGGAGTGCCTTGATCATTGGCGTGCTGTGAGGGAAGGATTCGCATTTGCTCATTGCACAACATGCAAGGCTCCATATCATTT...

Protein

Download Protein FASTA

322 aa · TkA02G451830|TK1151|PROTEIN

MADRDDPSPLVAPSLITEPMEIDLEAGPGEQIQCRICLETDGRDFIAPCKCRGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLRVHVLADRKWRTMKFRFFVTRDILFIFFSVQIVISILAYMVYLLDGYHKYWLRLAWGFDSETSFYYICGALLFFALLGLSGCFITCYDRRVRNDLAQPCRELCLCCCQPGVCADCHLPGTLCMWTDCTTCFESCASAAGECGCLGGAGEAGLPLIFIMALVVLGLFTVIGIFY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G451830`
TK1151 ID	TkA02G451830
OH-1004 ID	LXL04_014126
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G451830`
Location	Chr02:114956120-114965287 (+)
Description	Similar to SSM4: ERAD-associated E3 ubiquitin-protein ligase DOA10 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014126` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016567 protein ubiquitination Biological Process GO:0030970 retrograde protein transport, ER to cytosol Biological Process GO:0036503 ERAD pathway Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0000837 Doa10p ubiquitin ligase complex Cellular Component GO:0005635 nuclear envelope Cellular Component GO:0005637 nuclear inner membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0004842 ubiquitin-protein transferase activity Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	sce:YIL030C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.303

Rank 1 · TkA02G451830 · TK1151

Cell membrane0.297

Rank 2 · TkA02G451830 · TK1151

Golgi apparatus0.262

Rank 3 · TkA02G451830 · TK1151

Endoplasmic reticulum0.225

Rank 4 · TkA02G451830 · TK1151

Lysosome / Vacuole0.210

Rank 5 · TkA02G451830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12906RINGv34-81 aa

PF28413At5g65660_helical157-174 aa

PF12906RINGv173-187 aa

PF28413At5g65660_helical190-194 aa

PF12906RINGv214-233 aa

PF28413At5g65660_helical245-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G451830	`PF12906`	RINGv	34	81	1.6e-10	41.7
TkA02G451830	`PF28413`	At5g65660_helical	157	174	0.077	13.4
TkA02G451830	`PF12906`	RINGv	173	187	1.6e-10	41.7
TkA02G451830	`PF28413`	At5g65660_helical	190	194	0.077	13.4
TkA02G451830	`PF12906`	RINGv	214	233	1.6e-10	41.7
TkA02G451830	`PF28413`	At5g65660_helical	245	260	0.077	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card