TkA02G451500 | RubberDandelionOmics

Gene overview

TkA02G451500

Reference: TK1151 Chr: Chr02 Coordinates: 114878688-114879896 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1179 bp · TkA02G451500|TK1151|cDNA

ATGGGTTCCCAAGAAGACGACCACATCGCCACCGTCTACGGCGAAGATCTAGACGAAGACGATGAGAGCGAAGACGAAGATCTAACCTTGCCCAATCAGAACGTCGATGAAGATGATGTTGATTTGGTTGATGACGAGGAAGAGGATGATTCCGTTTCCTCCGGCGTCGGTGAAGTCACCATCGCCGTAGCTGGCGATCCCAGCGCCAACACCACCGTTGCCGCTACACCAACGGCAGCAATTACTGGCACGATCAACGC...

CDS

Download CDS FASTA

1179 bp · TkA02G451500|TK1151|CDS

ATGGGTTCCCAAGAAGACGACCACATCGCCACCGTCTACGGCGAAGATCTAGACGAAGACGATGAGAGCGAAGACGAAGATCTAACCTTGCCCAATCAGAACGTCGATGAAGATGATGTTGATTTGGTTGATGACGAGGAAGAGGATGATTCCGTTTCCTCCGGCGTCGGTGAAGTCACCATCGCCGTAGCTGGCGATCCCAGCGCCAACACCACCGTTGCCGCTACACCAACGGCAGCAATTACTGGCACGATCAACGC...

Protein

Download Protein FASTA

392 aa · TkA02G451500|TK1151|PROTEIN

MGSQEDDHIATVYGEDLDEDDESEDEDLTLPNQNVDEDDVDLVDDEEEDDSVSSGVGEVTIAVAGDPSANTTVAATPTAAITGTINATPITRSDGALEQRKIVPLDESRRLFQRLWTDEDEIELLQGFLDYTNQRLVNNPFHHHHHDTTAFYDQIKNKLQLDFNKNQLVEKLRRLKKKYRNVLSKISSGKEYVFKSAHDQITFDISCKIWSTEAALVSTPATADVGRFEDEEPNNPNHYPNPNLNLTFNLNEQNEKKIPR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G451500`
TK1151 ID	TkA02G451500
OH-1004 ID	LXL04_014128
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.600
Protein coverage (%)	TK1151 99.745 / OH-1004 88.987 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G451500

Location Chr02:114878688-114879896 (-)

Description Similar to At5g28040: Probable transcription factor At5g28040

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28040`	Probable transcription factor At5g28040.	No verified direct reference in this release
`At3g04930`	Probable transcription factor At3g04930.	No verified direct reference in this release
`At1g11510`	Probable transcription factor At1g11510.	No verified direct reference in this release
`At4g01260`	Probable transcription factor At4g01260.	No verified direct reference in this release
`At4g25210`	Transcription factor that binds promoters containing the CryR2 element, 5'-ACATAWCT-3'.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014128 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G11510

ath:AT3G04930

ath:AT4G00390

ath:AT4G01260

ath:AT5G28040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.984

Rank 1 · TkA02G451500 · TK1151

Cytoplasm0.067

Rank 2 · TkA02G451500 · TK1151

Cell membrane0.017

Rank 3 · TkA02G451500 · TK1151

Endoplasmic reticulum0.011

Rank 4 · TkA02G451500 · TK1151

Plastid0.009

Rank 5 · TkA02G451500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30410TrmJ_C109-135 aa

PF04504GeBP-like_DBD112-211 aa

PF13837Myb_DNA-bind_4116-190 aa

PF12776Myb_DNA-bind_3116-184 aa

PF10545MADF_DNA_bdg138-187 aa

PF30410TrmJ_C164-175 aa

PF12776Myb_DNA-bind_3370-387 aa

PF10545MADF_DNA_bdg376-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G451500	`PF30410`	TrmJ_C	109	135	0.022	15.4
TkA02G451500	`PF04504`	GeBP-like_DBD	112	211	1.1e-29	103.7
TkA02G451500	`PF13837`	Myb_DNA-bind_4	116	190	0.011	16.8
TkA02G451500	`PF12776`	Myb_DNA-bind_3	116	184	0.13	14.0
TkA02G451500	`PF10545`	MADF_DNA_bdg	138	187	0.023	15.7
TkA02G451500	`PF30410`	TrmJ_C	164	175	0.022	15.4
TkA02G451500	`PF12776`	Myb_DNA-bind_3	370	387	0.13	14.0
TkA02G451500	`PF10545`	MADF_DNA_bdg	376	388	0.023	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K5T4`	Arabidopsis thaliana	sp\|F4K5T4\|STKLU_ARATH Probable transcription factor At5g28040	44.700%	Swiss-Prot	Medium
`Q9CAV7`	Arabidopsis thaliana	sp\|Q9CAV7\|STKLJ_ARATH Probable transcription factor At3g04930	43.500%	Swiss-Prot	Medium
`C0SUU6`	Arabidopsis thaliana	sp\|C0SUU6\|STKLA_ARATH Probable transcription factor At1g11510	43.400%	Swiss-Prot	Low
`O04608`	Arabidopsis thaliana	sp\|O04608\|STKLR_ARATH Probable transcription factor At4g01260	39.400%	Swiss-Prot	Low
`Q9SB42`	Arabidopsis thaliana	sp\|Q9SB42\|STKLS_ARATH GLABROUS1 enhancer-binding protein-like	35.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card