TkA02G447730 | RubberDandelionOmics

Gene overview

TkA02G447730

Reference: TK1151 Chr: Chr02 Coordinates: 113843472-113844000 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · TkA02G447730|TK1151|cDNA

CATTCCCTCCGCCAATTCTACAAATCGTGTCGCATAAAAGGTAACGTCGATTTCATATTCGGAAACTCCGCATCCATCTTCCAGGACTGCACAATCCTCGTTCGTCCCCGTCAAACTGAAGCCGGAAAAGGGGAGACACAACGCCGTGACTGCACATGGAAGGATAGATCCGGCGCAGTCAACGGGATTTGTTTTCCAGAACTGTTTGATCAACGGGACCGAAGAGTACATGAAGTTATATTACAGCCATGGAAGGAGGT...

CDS

Download CDS FASTA

495 bp · TkA02G447730|TK1151|CDS

CATTCCCTCCGCCAATTCTACAAATCGTGTCGCATAAAAGGTAACGTCGATTTCATATTCGGAAACTCCGCATCCATCTTCCAGGACTGCACAATCCTCGTTCGTCCCCGTCAAACTGAAGCCGGAAAAGGGGAGACACAACGCCGTGACTGCACATGGAAGGATAGATCCGGCGCAGTCAACGGGATTTGTTTTCCAGAACTGTTTGATCAACGGGACCGAAGAGTACATGAAGTTATATTACAGCCATGGAAGGAGGT...

Protein

Download Protein FASTA

164 aa · TkA02G447730|TK1151|PROTEIN

HSLRQFYKSCRIKGNVDFIFGNSASIFQDCTILVRPRQTEAGKGETQRRDCTWKDRSGAVNGICFPELFDQRDRRVHEVILQPWKEVSRTVFIDCKLEALITPEGWMPWTGDFALKTLYYGEFDNSGKGANLTGRVTWSSRIPAERVDVYSIGNFLQGDQWKAC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G447730`
TK1151 ID	TkA02G447730
OH-1004 ID	LXL04_014204
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.200
Protein coverage (%)	TK1151 100.000 / OH-1004 31.362 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G447730

Location Chr02:113843472-113844000 (+)

Description Similar to PME51: Probable pectinesterase/pectinesterase inhibitor 51

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09760`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g64640`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At4g02330`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At2g47550`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014204 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042545 cell wall modification Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0052542 defense response by callose deposition Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004857 enzyme inhibitor activity Molecular Function

GO:0030599 pectinesterase activity Molecular Function

GO:0046910 pectinesterase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT3G05610

ath:AT5G09760

ath:AT5G49180

ath:AT5G64640

cit:102577945

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.492

Rank 1 · TkA02G447730 · TK1151

Cytoplasm0.171

Rank 2 · TkA02G447730 · TK1151

Lysosome / Vacuole0.115

Rank 3 · TkA02G447730 · TK1151

Endoplasmic reticulum0.098

Rank 4 · TkA02G447730 · TK1151

Nucleus0.047

Rank 5 · TkA02G447730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01095Pectinesterase1-159 aa

PF15863EELM286-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G447730	`PF01095`	Pectinesterase	1	159	2.1e-42	145.6
TkA02G447730	`PF15863`	EELM2	86	125	0.32	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXD9`	Arabidopsis thaliana	sp\|Q9LXD9\|PME51_ARATH Probable pectinesterase/pectinesterase inhibitor 51	53.800%	Swiss-Prot	High
`Q8L7Q7`	Arabidopsis thaliana	sp\|Q8L7Q7\|PME64_ARATH Probable pectinesterase/pectinesterase inhibitor 64	50.900%	Swiss-Prot	High
`Q8RXK7`	Arabidopsis thaliana	sp\|Q8RXK7\|PME41_ARATH Probable pectinesterase/pectinesterase inhibitor 41	39.800%	Swiss-Prot	Medium
`O22256`	Arabidopsis thaliana	sp\|O22256\|PME20_ARATH Probable pectinesterase/pectinesterase inhibitor 20	39.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card