RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G445650
Reference: TK1151 Chr: Chr02 Coordinates: 113221685-113224792 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1863 bp · TkA02G445650|TK1151|cDNA

ATGCACCCGTTTGATTTTTTGCATTTACTCATCTTGATTTGGTTAACAACAACATTATCAAAAGCTCAGACATTCAACATCGACACAGGGTGCAATCTCTGGTGTGGGGAGGTCAAGATTCCATTCCCTTTTGGGATTGGAAGAAATTGTTCAGCCAACGAATGTATCTCCTCAAAACCGTATTTATCTTCACTTGACAACTTGGAGGTGTTACATATAGAATCAAGGACGGTCACCGTTAAAGTGCCCACAATTAGTCC...

CDS

Download CDS FASTA

1863 bp · TkA02G445650|TK1151|CDS

ATGCACCCGTTTGATTTTTTGCATTTACTCATCTTGATTTGGTTAACAACAACATTATCAAAAGCTCAGACATTCAACATCGACACAGGGTGCAATCTCTGGTGTGGGGAGGTCAAGATTCCATTCCCTTTTGGGATTGGAAGAAATTGTTCAGCCAACGAATGTATCTCCTCAAAACCGTATTTATCTTCACTTGACAACTTGGAGGTGTTACATATAGAATCAAGGACGGTCACCGTTAAAGTGCCCACAATTAGTCC...

Protein

Download Protein FASTA

620 aa · TkA02G445650|TK1151|PROTEIN

MHPFDFLHLLILIWLTTTLSKAQTFNIDTGCNLWCGEVKIPFPFGIGRNCSANECISSKPYLSSLDNLEVLHIESRTVTVKVPTISPVDWQNQVKIGQNPFLISGLHNTFVVEGCGTASLMENGTIICGCSTTCGNNNTVSYLNVNDCFGVSCCQTTIPRDLKSFTFNLTRLERGSAYLVATNYVNKFSIQSNNTFVPISLSWNETVKPKECVDMCGEVSIPYLFGIGRHCAWDNWFVVDCNSSRPYLPALNNVEVLVVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G445650
TK1151 IDTkA02G445650
OH-1004 IDLXL04_014237
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)47.600
Protein coverage (%)TK1151 91.290 / OH-1004 99.499
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G445650
LocationChr02:113221685-113224792 (+)
DescriptionSimilar to WAKL2: Wall-associated receptor kinase-like 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g16130 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g16120 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g69730 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g16140 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g79670 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.
RESISTANCE TO FUSARIUM OXYSPORUM 1, a dominant Arabidopsis disease-resistance gene, is not race specific.2005 · DOI: 10.1534/genetics.105.042218

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014237 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0007166 cell surface receptor signaling pathway Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009505 plant-type cell wall Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005509 calcium ion binding Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0030247 polysaccharide binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G16120
ath:AT1G16130
ath:AT1G16260
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.833
Rank 1 · TkA02G445650 · TK1151
Cytoplasm0.091
Rank 2 · TkA02G445650 · TK1151
Endoplasmic reticulum0.072
Rank 3 · TkA02G445650 · TK1151
Nucleus0.064
Rank 4 · TkA02G445650 · TK1151
Extracellular0.027
Rank 5 · TkA02G445650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947GUB_WAK_bind31-82 aa
PF26757DUF8250112-162 aa
PF13947GUB_WAK_bind130-142 aa
PF13947GUB_WAK_bind212-268 aa
PF26757DUF8250215-259 aa
PF13947GUB_WAK_bind322-340 aa
PF00069Pkinase411-496 aa
PF07714PK_Tyr_Ser-Thr414-489 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G445650PF13947GUB_WAK_bind31821.9e-1248.1
TkA02G445650PF26757DUF82501121620.4711.3
TkA02G445650PF13947GUB_WAK_bind1301421.9e-1248.1
TkA02G445650PF13947GUB_WAK_bind2122681.9e-1248.1
TkA02G445650PF26757DUF82502152590.4711.3
TkA02G445650PF13947GUB_WAK_bind3223401.9e-1248.1
TkA02G445650PF00069Pkinase4114965.2e-1246.4
TkA02G445650PF07714PK_Tyr_Ser-Thr4144892.4e-1350.7
TkA02G445650PF07714PK_Tyr_Ser-Thr4915082.4e-1350.7
TkA02G445650PF00069Pkinase4915055.2e-1246.4
TkA02G445650PF07714PK_Tyr_Ser-Thr5525772.4e-1350.7
TkA02G445650PF00069Pkinase5535745.2e-1246.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q7X8C5Arabidopsis thalianasp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 231.700%Swiss-ProtMedium
Q9S9M5Arabidopsis thalianasp|Q9S9M5|WAKLA_ARATH Wall-associated receptor kinase-like 130.600%Swiss-ProtMedium
Q9C9L5Arabidopsis thalianasp|Q9C9L5|WAKLH_ARATH Wall-associated receptor kinase-like 930.900%Swiss-ProtMedium
Q9S9M3Arabidopsis thalianasp|Q9S9M3|WAKLC_ARATH Wall-associated receptor kinase-like 330.100%Swiss-ProtMedium
Q8RY17Arabidopsis thalianasp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 2230.400%Swiss-ProtMedium

JBrowse

View in Genome Browser