TkA02G441240 | RubberDandelionOmics

Gene overview

TkA02G441240

Reference: TK1151 Chr: Chr02 Coordinates: 112162309-112163596 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · TkA02G441240|TK1151|cDNA

ATGAGCGAAGATTCATCCAGTAGTACCGTTACTGATGGCGGTGGTGCAAACGCAAATGAAGCAGAGAAGACTACAATAGAGCCAATTCGAATGCCTACTGTAGAAGAAATTAGGGGACAAGATATATGGAACAATTGTGCTGTTCGCAGCGTTGCCAGCGGAGTCATGGGAGGTGGACTTGGGTTGGCTATGGGGTTGTTTCTTGGTGCACTTGACAATCCAATAATGCAGGATGAAATGAGTGGTAGACAGCAGTTTAT...

CDS

Download CDS FASTA

525 bp · TkA02G441240|TK1151|CDS

ATGAGCGAAGATTCATCCAGTAGTACCGTTACTGATGGCGGTGGTGCAAACGCAAATGAAGCAGAGAAGACTACAATAGAGCCAATTCGAATGCCTACTGTAGAAGAAATTAGGGGACAAGATATATGGAACAATTGTGCTGTTCGCAGCGTTGCCAGCGGAGTCATGGGAGGTGGACTTGGGTTGGCTATGGGGTTGTTTCTTGGTGCACTTGACAATCCAATAATGCAGGATGAAATGAGTGGTAGACAGCAGTTTAT...

Protein

Download Protein FASTA

174 aa · TkA02G441240|TK1151|PROTEIN

MSEDSSSSTVTDGGGANANEAEKTTIEPIRMPTVEEIRGQDIWNNCAVRSVASGVMGGGLGLAMGLFLGALDNPIMQDEMSGRQQFIYTAKQMGRRSWGSCKAFAVMGFIFSAAECVVEQARAKHDMTNTVVAGCVTGGAISAKGSGPKAACVGCAGFAAFSVVIEKFLDRHEG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G441240`
TK1151 ID	TkA02G441240
OH-1004 ID	LXL04_014294
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G441240

Location Chr02:112162309-112163596 (+)

Description Similar to TIM22-1: Mitochondrial import inner membrane translocase subunit TIM22-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10110`	Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane.	Characterization of the preprotein and amino acid transporter gene family in Arabidopsis.2007 · DOI: 10.1104/pp.106.090688
`At1g18320`	Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014294 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0045039 protein insertion into mitochondrial inner membrane Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0042721 TIM22 mitochondrial import inner membrane insertion complex Cellular Component

GO:0005198 structural molecule activity Molecular Function

GO:0008320 protein transmembrane transporter activity Molecular Function

GO:0030943 mitochondrion targeting sequence binding Molecular Function

KEGG gene cross-reference

ath:AT1G18320

ath:AT3G10110

cal:CAALFM_C208310WA

cgr:2888408

kla:KLLA0_D08536g

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.932

Rank 1 · TkA02G441240 · TK1151

Cytoplasm0.066

Rank 2 · TkA02G441240 · TK1151

Nucleus0.049

Rank 3 · TkA02G441240 · TK1151

Plastid0.036

Rank 4 · TkA02G441240 · TK1151

Cell membrane0.028

Rank 5 · TkA02G441240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02466Tim1746-162 aa

PF04884UVB_sens_prot47-123 aa

PF30969DUF876750-96 aa

PF30969DUF8767119-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G441240	`PF02466`	Tim17	46	162	6.6e-28	97.9
TkA02G441240	`PF04884`	UVB_sens_prot	47	123	0.18	12.1
TkA02G441240	`PF30969`	DUF8767	50	96	6.7e-06	26.9
TkA02G441240	`PF30969`	DUF8767	119	165	6.7e-06	26.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2RVP7`	Arabidopsis thaliana	sp\|A2RVP7\|TI221_ARATH Mitochondrial import inner membrane translocase subunit TIM22-1	70.200%	Swiss-Prot	High
`A1XJK0`	Arabidopsis thaliana	sp\|A1XJK0\|TI224_ARATH Mitochondrial import inner membrane translocase subunit TIM22-4	76.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card