TkA02G431410 | RubberDandelionOmics

Gene overview

TkA02G431410

Reference: TK1151 Chr: Chr02 Coordinates: 109540049-109542107 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1263 bp · TkA02G431410|TK1151|cDNA

CCCGTAAACAACGCTGGCGATCATGCCTTTTATGTGTCCACTGTTTTATAGTATAAAACTGCGCTTCCTTACAATTTTATGGTATTCCACCGGAATTAAACTTAAAGCTTCCAACGGTTGCACATGGGCCGCATCGAGGAAAATCCAGTTCCTCACCACGCCTCCGATCAAACCCCATCTCAACCACCACCGCCACCACCACCACAAGGCTACACGAACCACCATGACAACCCTCTATCATCACCGGCACAACCAGTACC...

CDS

Download CDS FASTA

951 bp · TkA02G431410|TK1151|CDS

ATGGGCCGCATCGAGGAAAATCCAGTTCCTCACCACGCCTCCGATCAAACCCCATCTCAACCACCACCGCCACCACCACCACAAGGCTACACGAACCACCATGACAACCCTCTATCATCACCGGCACAACCAGTACCACAGGCGGCTTACATGGGCCATAATGACCAGCATATGAACCACCCACAATCCACTCGTTCATACGTACATCAGTCGCCGGAAAATTTGCCGCCACCTGAGGCTTACCCACCACAAAAACCCCA...

Protein

Download Protein FASTA

316 aa · TkA02G431410|TK1151|PROTEIN

MGRIEENPVPHHASDQTPSQPPPPPPPQGYTNHHDNPLSSPAQPVPQAAYMGHNDQHMNHPQSTRSYVHQSPENLPPPEAYPPQKPQTYPPQQTPETYPPAAHSPHPGPVSFPPQQQPATYPPQTPESYPSPLHQPPVGNYNPQINYNAQPQPQPQAVVMNYGGTQNGVPIGVQCQGTQGWTTGILDCLDDPENAILTLCFPFVTFGQIAEIIDNGQTSCATNGLIYGLVAAFIGIPCIISCSYRTKLRSRYGLMETAPD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G431410`
TK1151 ID	TkA02G431410
OH-1004 ID	LXL04_014378
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G431410

Location Chr02:109540049-109542107 (+)

Description Similar to PCR6: Protein PLANT CADMIUM RESISTANCE 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49030`	May be involved in heavy metals transport.	No verified direct reference in this release
`At3g18460`	May be involved in heavy metals transport.	No verified direct reference in this release
`At3g18470`	May be involved in heavy metals transport.	No verified direct reference in this release
`At3g18450`	May be involved in heavy metals transport.	No verified direct reference in this release
`At5g35525`	May be involved in heavy metals transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014378 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G49030

ath:AT3G18450

ath:AT3G18460

ath:AT3G18470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.509

Rank 1 · TkA02G431410 · TK1151

Cytoplasm0.309

Rank 2 · TkA02G431410 · TK1151

Nucleus0.133

Rank 3 · TkA02G431410 · TK1151

Endoplasmic reticulum0.112

Rank 4 · TkA02G431410 · TK1151

Golgi apparatus0.106

Rank 5 · TkA02G431410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04749PLAC8181-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G431410	`PF04749`	PLAC8	181	278	1.1e-27	97.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9A5`	Arabidopsis thaliana	sp\|Q9M9A5\|PCR6_ARATH Protein PLANT CADMIUM RESISTANCE 6	58.800%	Swiss-Prot	Low
`Q9LS44`	Arabidopsis thaliana	sp\|Q9LS44\|PCR4_ARATH Protein PLANT CADMIUM RESISTANCE 4	52.000%	Swiss-Prot	Low
`Q9LS43`	Arabidopsis thaliana	sp\|Q9LS43\|PCR7_ARATH Protein PLANT CADMIUM RESISTANCE 7	51.800%	Swiss-Prot	Low
`Q9LS45`	Arabidopsis thaliana	sp\|Q9LS45\|PCR5_ARATH Protein PLANT CADMIUM RESISTANCE 5	43.700%	Swiss-Prot	Medium
`P0CW97`	Arabidopsis thaliana	sp\|P0CW97\|PCR3_ARATH Protein PLANT CADMIUM RESISTANCE 3	48.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card