TkA02G431400 | RubberDandelionOmics

Gene overview

TkA02G431400

Reference: TK1151 Chr: Chr02 Coordinates: 109532926-109536713 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2955 bp · TkA02G431400|TK1151|cDNA

AGACGGTCTTAATTAAGACACAAACCAAAACCTGGTGCACTTTACTCTATATTTAGTGATGACTTGGATAGTTGGATATCATGTAACAACCTTTATCTTTTTCAAAATATAATCAACATTATTCCTTCGTTTGAAAATGTAATCGCACATATAGCATCTCTTAATCCTATATTTTCGAATTATTGTCCCAATTCTCTCTCATCTCTGAAATATAGGCCTTTCCCCCTTTATTAGGGTTTCTGATTCCTCCTACAATTCTG...

CDS

Download CDS FASTA

1833 bp · TkA02G431400|TK1151|CDS

ATGAGAACCTCGTCCTCGTGGGCTGATGCTGTTGATCATGCAGATGGTTATGGGGTTGGCGGAGCTTCCAATGCTCCCCCAAAACCCGCATATGTCCCCCCTCATCTTCGTAACAGGCCACGCACCCCCGACCAAATGGCGGGCCCACCTACATCAAACAATGGCCCAGCTCCCATTAACGATAGGTTAGGATACCCCAATCAAACAAGCGGCTCACGGTGGTCCAGCCCTAGGGTTGAGTACAGTCGGTCAGGGTACAA...

Protein

Download Protein FASTA

610 aa · TkA02G431400|TK1151|PROTEIN

MRTSSSWADAVDHADGYGVGGASNAPPKPAYVPPHLRNRPRTPDQMAGPPTSNNGPAPINDRLGYPNQTSGSRWSSPRVEYSRSGYNTGGRGGGGGGSGGGGNRGGWGTRGGREFEANPFDTDELDSAEEIASDNESNGINFDAYEDIPVETSGVNVPPPVNTFAEIDLGEALNLNIRRCKYVKPTPVQRYTIPISLAGRDLMACAQTGSGKTAAFCFPIISGIMRGQSVQRPHGFRTVFPLALILAPTRELSCQIHVEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G431400`
TK1151 ID	TkA02G431400
OH-1004 ID	LXL04_014379
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G431400

Location Chr02:109532926-109536713 (+)

Description Similar to RH37: DEAD-box ATP-dependent RNA helicase 37

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42520`	DEAD-box ATP-dependent RNA helicase 37.	No verified direct reference in this release
`At3g58510`	DEAD-box ATP-dependent RNA helicase 11.	No verified direct reference in this release
`At3g58570`	DEAD-box ATP-dependent RNA helicase 52.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0805200`	DEAD-box ATP-dependent RNA helicase 37.	No verified direct reference in this release
`Os07g0202100`	DEAD-box ATP-dependent RNA helicase 52B.	No verified direct reference in this release
`Os11g0599500`	DEAD-box ATP-dependent RNA helicase 52C.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014379 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0003724 RNA helicase activity Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT2G42520

ath:AT3G58510

ath:AT3G58570

dosa:Os03g0805200

dosa:Os11g0599500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.632

Rank 1 · TkA02G431400 · TK1151

Nucleus0.541

Rank 2 · TkA02G431400 · TK1151

Endoplasmic reticulum0.061

Rank 3 · TkA02G431400 · TK1151

Cell membrane0.051

Rank 4 · TkA02G431400 · TK1151

Mitochondrion0.036

Rank 5 · TkA02G431400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270DEAD186-365 aa

PF04851ResIII202-359 aa

PF00271Helicase_C243-297 aa

PF06212GRIM-19343-414 aa

PF00271Helicase_C402-515 aa

PF22590Cas3-like_C_2448-514 aa

PF00270DEAD534-563 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G431400	`PF00270`	DEAD	186	365	1.9e-47	161.8
TkA02G431400	`PF04851`	ResIII	202	359	0.083	13.5
TkA02G431400	`PF00271`	Helicase_C	243	297	3.2e-32	111.8
TkA02G431400	`PF06212`	GRIM-19	343	414	0.23	12.1
TkA02G431400	`PF00271`	Helicase_C	402	515	3.2e-32	111.8
TkA02G431400	`PF22590`	Cas3-like_C_2	448	514	0.15	13.0
TkA02G431400	`PF00270`	DEAD	534	563	1.9e-47	161.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W89`	Arabidopsis thaliana	sp\|Q84W89\|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37	75.000%	Swiss-Prot	High
`Q8LA13`	Arabidopsis thaliana	sp\|Q8LA13\|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11	71.600%	Swiss-Prot	High
`Q9M2F9`	Arabidopsis thaliana	sp\|Q9M2F9\|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52	74.000%	Swiss-Prot	High
`Q75HJ0`	Oryza sativa subsp. japonica	sp\|Q75HJ0\|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37	69.900%	Swiss-Prot	High
`Q6Z4K6`	Oryza sativa subsp. japonica	sp\|Q6Z4K6\|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B	69.100%	Swiss-Prot	High
`Q2R1M8`	Oryza sativa subsp. japonica	sp\|Q2R1M8\|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C	81.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card