TkA02G428800 | RubberDandelionOmics

Gene overview

TkA02G428800

Reference: TK1151 Chr: Chr02 Coordinates: 108928212-108931013 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2446 bp · TkA02G428800|TK1151|cDNA

AATTAATCCAAATCACTGCGCTTGAAAATTCAACACAGTATCATGTCCTTGATATTATTAATCCTCACATCACATGCCTCCCCCTTTCCCCTCCCTCCTTTCCACCTCATCCATATGCTGATTCGTTCCATACTCTTCTAATCTCTGCGTGCTCTTCATAACTCATTACAGACATTTGTCCTCTTTACTTAATCAAGAAATCCTCTCACACCTCTGTAAATCTCATCAAAATCCCTTCTCTTTTACTCCAGAAAATTTCC...

CDS

Download CDS FASTA

1782 bp · TkA02G428800|TK1151|CDS

ATGTCGAGACAGAGTAACCGAGTTGTGGACGGCTTGATCCCAGGTTACGGTAAGATCCGGAAACGAGGGTGTTCTTCATCACCATCCTCATCTTCTAAAGTCCATAATTACCGATTTAAACGGGCAATTATGGTGGGGAAGAGCCGGGTCGGAGGTGGGTCCAGATCCAGTACGCCGGCACCCTCGTGGAGGATGACACCATCTTCTAAATCCAAGCTTGGTGGTGGTGTGGAGTCGCCTAATTACGATGGCGGCGGAGG...

Protein

Download Protein FASTA

593 aa · TkA02G428800|TK1151|PROTEIN

MSRQSNRVVDGLIPGYGKIRKRGCSSSPSSSSKVHNYRFKRAIMVGKSRVGGGSRSSTPAPSWRMTPSSKSKLGGGVESPNYDGGGGRSRPVSARKLAATLWEMNEMPSPQNMETTRRRKEKETTRVREKTHRPVHTPGSLPPHLSDPSHSPVSERMERSGTGSHHRTSISHKLKLEDNNGGNFDSFSNASLMETETRYHAQTPNTSSITVNPRLKDVSNALTTSKELLKIIHRMWAHDNLPSSSMSLISALHTELERAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G428800`
TK1151 ID	TkA02G428800
OH-1004 ID	LXL04_014401
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 96.423 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G428800

Location Chr02:108928212-108931013 (+)

Description Similar to At5g41620: Uncharacterized protein At5g41620

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41620`	Uncharacterized protein At5g41620.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014401 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G41620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.472

Rank 1 · TkA02G428800 · TK1151

Nucleus0.361

Rank 2 · TkA02G428800 · TK1151

Cell membrane0.326

Rank 3 · TkA02G428800 · TK1151

Endoplasmic reticulum0.040

Rank 4 · TkA02G428800 · TK1151

Plastid0.031

Rank 5 · TkA02G428800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09036Bcr-Abl_Oligo239-292 aa

PF15456Uds1293-366 aa

PF09036Bcr-Abl_Oligo326-349 aa

PF04468PSP1332-358 aa

PF15456Uds1372-417 aa

PF19823DUF6305377-451 aa

PF04468PSP1382-422 aa

PF09036Bcr-Abl_Oligo383-407 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G428800	`PF09036`	Bcr-Abl_Oligo	239	292	0.34	11.6
TkA02G428800	`PF15456`	Uds1	293	366	1.2	10.1
TkA02G428800	`PF09036`	Bcr-Abl_Oligo	326	349	0.34	11.6
TkA02G428800	`PF04468`	PSP1	332	358	1.7	9.7
TkA02G428800	`PF15456`	Uds1	372	417	1.2	10.1
TkA02G428800	`PF19823`	DUF6305	377	451	0.23	11.8
TkA02G428800	`PF04468`	PSP1	382	422	1.7	9.7
TkA02G428800	`PF09036`	Bcr-Abl_Oligo	383	407	0.34	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66GQ2`	Arabidopsis thaliana	sp\|Q66GQ2\|Y5162_ARATH Uncharacterized protein At5g41620	30.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card