TkA02G428010 | RubberDandelionOmics

Gene overview

TkA02G428010

Reference: TK1151 Chr: Chr02 Coordinates: 108755151-108755825 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

675 bp · TkA02G428010|TK1151|cDNA

ATGGCTGCCACCGGGGAAATAGAGCCATCGATAGAGCCTGTGATTCGAGGGTTAAGTAGCGACAGGTTCTTTTTCAAGCCGGGGAAAACAAACTCCATACTTGAAGAAGCAAAACGAAACGAAAAAGAAAAAGAAAGCGTTTTACCATTCAAAGAAAGTGTGTCAATGATGGAGATGGATTCAACTGACCCATTTGTTGACTTCAAGAAGTCAATGCAAGAGATGGTGGAAGCTGATGAAGGGTTAAAAGAATGGGAGAA...

CDS

Download CDS FASTA

675 bp · TkA02G428010|TK1151|CDS

ATGGCTGCCACCGGGGAAATAGAGCCATCGATAGAGCCTGTGATTCGAGGGTTAAGTAGCGACAGGTTCTTTTTCAAGCCGGGGAAAACAAACTCCATACTTGAAGAAGCAAAACGAAACGAAAAAGAAAAAGAAAGCGTTTTACCATTCAAAGAAAGTGTGTCAATGATGGAGATGGATTCAACTGACCCATTTGTTGACTTCAAGAAGTCAATGCAAGAGATGGTGGAAGCTGATGAAGGGTTAAAAGAATGGGAGAA...

Protein

Download Protein FASTA

224 aa · TkA02G428010|TK1151|PROTEIN

MAATGEIEPSIEPVIRGLSSDRFFFKPGKTNSILEEAKRNEKEKESVLPFKESVSMMEMDSTDPFVDFKKSMQEMVEADEGLKEWENLQELLSLYLAVNDKINHCYIIRAFVDLMLVNIGTSSTSPSSCSSSSSMNLQDQSLLMEESGGGNNKKMIISSASPESALSFTSSSASSSGTCSSTSHCLSSCSLEEEDEDDDDDDDADDNSVQKVVVSDNASSYSKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G428010`
TK1151 ID	TkA02G428010
OH-1004 ID	LXL04_012813
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.600
Protein coverage (%)	TK1151 53.571 / OH-1004 49.035 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G428010

Location Chr02:108755151-108755825 (-)

Description Similar to OFP13: Transcription repressor OFP13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36050`	Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	Arabidopsis ovate family proteins, a novel transcriptional repressor family, control multiple aspects of plant growth and development.2011 · DOI: 10.1371/journal.pone.0023896
`At5g04820`	Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	No verified direct reference in this release
`At1g05420`	Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012813 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:1900457 regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G79960

ath:AT2G36050

ath:AT3G52540

ath:AT5G04820

dosa:Os01g0864000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.414

Rank 1 · TkA02G428010 · TK1151

Nucleus0.404

Rank 2 · TkA02G428010 · TK1151

Cell membrane0.287

Rank 3 · TkA02G428010 · TK1151

Endoplasmic reticulum0.080

Rank 4 · TkA02G428010 · TK1151

Plastid0.041

Rank 5 · TkA02G428010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04844Ovate55-59 aa

PF04844Ovate61-116 aa

PF12435DUF3678114-133 aa

PF12435DUF3678157-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G428010	`PF04844`	Ovate	55	59	1.3e-21	77.0
TkA02G428010	`PF04844`	Ovate	61	116	1.3e-21	77.0
TkA02G428010	`PF12435`	DUF3678	114	133	0.0017	18.5
TkA02G428010	`PF12435`	DUF3678	157	171	0.0017	18.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ45`	Arabidopsis thaliana	sp\|Q9SJ45\|OPF15_ARATH Transcription repressor OFP15	47.800%	Swiss-Prot	Low
`Q9FMC8`	Arabidopsis thaliana	sp\|Q9FMC8\|OPF13_ARATH Transcription repressor OFP13	42.100%	Swiss-Prot	Medium
`F4I8R6`	Arabidopsis thaliana	sp\|F4I8R6\|OFP12_ARATH Transcription repressor OFP12	45.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card