TkA02G424520 | RubberDandelionOmics

Gene overview

TkA02G424520

Reference: TK1151 Chr: Chr02 Coordinates: 107826342-107828177 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · TkA02G424520|TK1151|cDNA

TTACAATTCAACTTAAACAGGTACACAGATACGTTATTCTTATCTGACAGAGAAGTAAACAGAATTACTATATTTGTGAATAATGATGTATTTAAAGGTGAAGAACAGAAGCCTGTTTCCACCAGCAATGTGACGACAGCCTTGTCCGGAAACTATGAACTGAGGCAAAAATCGAAAGATGAGAATGGTGAATTTGAGACATTAGAAGTTACTGGTTATGACTACTTTGTGAATTACTGCAAGATTGATCTCCGATATTC...

CDS

Download CDS FASTA

651 bp · TkA02G424520|TK1151|CDS

TTACAATTCAACTTAAACAGGTACACAGATACGTTATTCTTATCTGACAGAGAAGTAAACAGAATTACTATATTTGTGAATAATGATGTATTTAAAGGTGAAGAACAGAAGCCTGTTTCCACCAGCAATGTGACGACAGCCTTGTCCGGAAACTATGAACTGAGGCAAAAATCGAAAGATGAGAATGGTGAATTTGAGACATTAGAAGTTACTGGTTATGACTACTTTGTGAATTACTGCAAGATTGATCTCCGATATTC...

Protein

Download Protein FASTA

216 aa · TkA02G424520|TK1151|PROTEIN

LQFNLNRYTDTLFLSDREVNRITIFVNNDVFKGEEQKPVSTSNVTTALSGNYELRQKSKDENGEFETLEVTGYDYFVNYCKIDLRYSVCSLVSLQRYTKALNTMQRASLVEKSRQKPQERMRVLTDALKLNNYDAEPLLKSCGISINSGFTQVEGCVLPAPRLKVGYSCMCTPYFGENLEDHAQVNDVLAEMGTYFQMQVNIMIDDYLDCFGAPDS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G424520`
TK1151 ID	TkA02G424520
OH-1004 ID	LXL04_008230
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	76.900
Protein coverage (%)	TK1151 78.241 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G424520

Location Chr02:107826342-107828177 (-)

Description Similar to FDS-2: Farnesyl diphosphate synthase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27040`	Together with RDM3, required for transcriptional gene silencing (TGS) by DNA methylation and repressive histone modifications (H3K9me2) of several chromatin loci.	ARGONAUTE4 control of locus-specific siRNA accumulation and DNA and histone methylation.2003 · DOI: 10.1126/science.1079695 Role of Arabidopsis ARGONAUTE4 in RNA-directed DNA methylation triggered by inverted repeats.2004 · DOI: 10.1016/j.cub.2004.06.055 The Arabidopsis chromatin-modifying nuclear siRNA pathway involves a nucleolar RNA processing center.2006 · DOI: 10.1016/j.cell.2006.05.031 An ARGONAUTE4-containing nuclear processing center colocalized with Cajal bodies in Arabidopsis thaliana.2006 · DOI: 10.1016/j.cell.2006.05.032 Distinct catalytic and non-catalytic roles of ARGONAUTE4 in RNA-directed DNA methylation.2006 · DOI: 10.1038/nature05198 Reiterated WG/GW motifs form functionally and evolutionarily conserved ARGONAUTE-binding platforms in RNAi-related components.2007 · DOI: 10.1101/gad.451207 ARGONAUTE4 is required for resistance to Pseudomonas syringae in Arabidopsis.2007 · DOI: 10.1105/tpc.107.054494 Sorting of small RNAs into Arabidopsis argonaute complexes is directed by the 5' terminal nucleotide.2008 · DOI: 10.1016/j.cell.2008.02.034 Viral genome methylation as an epigenetic defense against geminiviruses.2008 · DOI: 10.1128/jvi.00719-08 RNA polymerase V transcription guides ARGONAUTE4 to chromatin.2009 · DOI: 10.1038/ng.365 The Arabidopsis RNA-directed DNA methylation argonautes functionally diverge based on their expression and interaction with target loci.2010 · DOI: 10.1105/tpc.109.072199 Independent chromatin binding of ARGONAUTE4 and SPT5L/KTF1 mediates transcriptional gene silencing.2011 · DOI: 10.1371/journal.pgen.1002120
`At5g21030`	Involved in RNA-mediated post-transcriptional gene silencing (PTGS).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0275600`	Probably involved in the RNA silencing pathway.	No verified direct reference in this release
`Os04g0151800`	Probably involved in the RNA silencing pathway.	No verified direct reference in this release
`Os07g0265600`	Probably involved in the RNA silencing pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008230 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006417 regulation of translation Biological Process

GO:0030422 siRNA processing Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0031048 regulatory ncRNA-mediated heterochromatin formation Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051607 defense response to virus Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0000791 euchromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G27040

ath:AT5G21030

dosa:Os01g0275600

dosa:Os04g0151800

dosa:Os07g0265600

osa:4324438

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.452

Rank 1 · TkA02G424520 · TK1151

Cytoplasm0.439

Rank 2 · TkA02G424520 · TK1151

Mitochondrion0.119

Rank 3 · TkA02G424520 · TK1151

Cell membrane0.070

Rank 4 · TkA02G424520 · TK1151

Endoplasmic reticulum0.058

Rank 5 · TkA02G424520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02170PAZ61-87 aa

PF05197TRIC75-112 aa

PF00348polyprenyl_synt85-111 aa

PF02170PAZ88-109 aa

PF16488ArgoL2119-164 aa

PF00348polyprenyl_synt169-215 aa

PF09628YvfG171-208 aa

PF02170PAZ194-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G424520	`PF02170`	PAZ	61	87	0.12	13.1
TkA02G424520	`PF05197`	TRIC	75	112	0.045	14.0
TkA02G424520	`PF00348`	polyprenyl_synt	85	111	0.00053	20.0
TkA02G424520	`PF02170`	PAZ	88	109	0.12	13.1
TkA02G424520	`PF16488`	ArgoL2	119	164	1.8e-11	44.8
TkA02G424520	`PF00348`	polyprenyl_synt	169	215	0.00053	20.0
TkA02G424520	`PF09628`	YvfG	171	208	0.11	13.6
TkA02G424520	`PF02170`	PAZ	194	206	0.12	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVD5`	Arabidopsis thaliana	sp\|Q9ZVD5\|AGO4_ARATH Protein argonaute 4	47.600%	Swiss-Prot	Medium
`Q3E984`	Arabidopsis thaliana	sp\|Q3E984\|AGO8_ARATH Protein argonaute 8	46.900%	Swiss-Prot	Medium
`Q9SDG8`	Oryza sativa subsp. japonica	sp\|Q9SDG8\|AGO4A_ORYSJ Protein argonaute 4A	55.600%	Swiss-Prot	Medium
`Q0JF58`	Oryza sativa subsp. japonica	sp\|Q0JF58\|AGO4B_ORYSJ Protein argonaute 4B	53.300%	Swiss-Prot	Medium
`Q6YSJ5`	Oryza sativa subsp. japonica	sp\|Q6YSJ5\|AGO16_ORYSJ Protein argonaute 16	48.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card