TkA02G423250 | RubberDandelionOmics

Gene overview

TkA02G423250

Reference: TK1151 Chr: Chr02 Coordinates: 107486594-107491518 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2669 bp · TkA02G423250|TK1151|cDNA

GTTTACCACTCCTTTTTGGGCCTGGTCTTTTTATCACTCTATTTTATTCACTCAACATCAACTTCACATGTTTACATTGTTTATTTAGGGCTCAACAATATTCAAGATCCTATACTAACTTCAAATTACCATCTCCAACTCCTTTCGAATGTCGTTCCAAGTCAACAAGATGCAAGGAAATCCATGCTTTATAGCTACAAACATAGTTTCTCGGGCTTTTCAGCAAAAATTAACTCAACACAAGCAGCCACCTTAGCCAG...

CDS

Download CDS FASTA

2370 bp · TkA02G423250|TK1151|CDS

GTTTACCACTCCTTTTTGGGCCTGGTCTTTTTATCACTCTATTTTATTCACTCAACATCAACTTCACATGTTTACATTGTTTATTTAGGGCTCAACAATATTCAAGATCCTATACTAACTTCAAATTACCATCTCCAACTCCTTTCGAATGTCGTTCCAAGTCAACAAGATGCAAGGAAATCCATGCTTTATAGCTACAAACATAGTTTCTCGGGCTTTTCAGCAAAAATTAACTCAACACAAGCAGCCACCTTAGCCAG...

Protein

Download Protein FASTA

789 aa · TkA02G423250|TK1151|PROTEIN

VYHSFLGLVFLSLYFIHSTSTSHVYIVYLGLNNIQDPILTSNYHLQLLSNVVPSQQDARKSMLYSYKHSFSGFSAKINSTQAATLARMDRVISVFKSRILRLHTTRSWDFMGLHLDPIGDQETPLQLTHGDNTIVALFDTGVWPESKSFHEEPNMHPIPKTWRGKCVKGQDFDPKTSCNLKLIGARYYLKGYEQEHGPLNTTVTSEYRSSRDANGHGTHTASTAVGSTVKKASFLGIGLGTARGGAPRARLAVYKVCWED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G423250`
TK1151 ID	TkA02G423250
OH-1004 ID	LXL04_014464
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 99.621 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G423250

Location Chr02:107486594-107491518 (-)

Description Similar to SBT3.18: Subtilisin-like protease SBT3.18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26330`	Subtilisin-like protease SBT3.18.	No verified direct reference in this release
`At4g10520`	Subtilisin-like protease SBT3.9.	No verified direct reference in this release
`At4g21650`	Subtilisin-like protease SBT3.13.	No verified direct reference in this release
`At4g21630`	Subtilisin-like protease SBT3.14.	No verified direct reference in this release
`At4g10530`	Subtilisin-like protease SBT3.10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014464 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005829 cytosol Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT4G21630

ath:AT4G21650

ath:AT4G26330

ath:AT5G45650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.462

Rank 1 · TkA02G423250 · TK1151

Lysosome / Vacuole0.157

Rank 2 · TkA02G423250 · TK1151

Cell membrane0.096

Rank 3 · TkA02G423250 · TK1151

Cytoplasm0.091

Rank 4 · TkA02G423250 · TK1151

Endoplasmic reticulum0.084

Rank 5 · TkA02G423250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922Inhibitor_I924-103 aa

PF21864MORF_dom42-96 aa

PF00082Peptidase_S8130-582 aa

PF21864MORF_dom248-260 aa

PF21864MORF_dom455-472 aa

PF21864MORF_dom616-643 aa

PF17766fn3_6661-757 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G423250	`PF05922`	Inhibitor_I9	24	103	6.3e-15	56.3
TkA02G423250	`PF21864`	MORF_dom	42	96	8.6e-05	23.0
TkA02G423250	`PF00082`	Peptidase_S8	130	582	1e-43	150.4
TkA02G423250	`PF21864`	MORF_dom	248	260	8.6e-05	23.0
TkA02G423250	`PF21864`	MORF_dom	455	472	8.6e-05	23.0
TkA02G423250	`PF21864`	MORF_dom	616	643	8.6e-05	23.0
TkA02G423250	`PF17766`	fn3_6	661	757	1.2e-25	90.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STQ2`	Arabidopsis thaliana	sp\|Q9STQ2\|SBT3I_ARATH Subtilisin-like protease SBT3.18	58.500%	Swiss-Prot	High
`Q9ZSB0`	Arabidopsis thaliana	sp\|Q9ZSB0\|SBT39_ARATH Subtilisin-like protease SBT3.9	40.700%	Swiss-Prot	Medium
`Q8GUK4`	Arabidopsis thaliana	sp\|Q8GUK4\|SBT3D_ARATH Subtilisin-like protease SBT3.13	42.100%	Swiss-Prot	Medium
`Q9SVT4`	Arabidopsis thaliana	sp\|Q9SVT4\|SBT3E_ARATH Subtilisin-like protease SBT3.14	41.800%	Swiss-Prot	Medium
`Q9ZSB1`	Arabidopsis thaliana	sp\|Q9ZSB1\|SBT3A_ARATH Subtilisin-like protease SBT3.10	40.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card