TkA02G421780 | RubberDandelionOmics

Gene overview

TkA02G421780

Reference: TK1151 Chr: Chr02 Coordinates: 107098528-107101909 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1535 bp · TkA02G421780|TK1151|cDNA

TTAAATCGTTGAAGTTTTGATCATATCTCTTCATGTCCTTGCTTGTTTGTTGATCAGTGCGGCCGGCGGAGCTATCTATGAGAGTGAAGCAAACGGTCACATAGATTGTGTGTTAAAAAACGATCGTTTGTGCCTCGACAGTCTTCTCTTTGTAGCAAAACAAAGATGATTCTAATCAGGTCGATTCGTCCAAATCGCCGGGCTTTTTCGTCACTGTTGGATCTGCAACCGCGCTCGCTGTACTTCTCCTCGTCGGCGGC...

CDS

Download CDS FASTA

1134 bp · TkA02G421780|TK1151|CDS

ATGATTCTAATCAGGTCGATTCGTCCAAATCGCCGGGCTTTTTCGTCACTGTTGGATCTGCAACCGCGCTCGCTGTACTTCTCCTCGTCGGCGGCGGCTGTGGAAGCAGAGCGAACGATACGAGAAGGTCCGAGAACTGATTGGAAAAAAGAAGAGATTAAGTCCGTTTACGACTCTCCTCTGCTCGACCTTCTCTTTCATGGAGCTCAAGTTCATAGACATGCTCAAAACTTTAGGGAAGTTCAGCAGTGTACGCTTCT...

Protein

Download Protein FASTA

377 aa · TkA02G421780|TK1151|PROTEIN

MILIRSIRPNRRAFSSLLDLQPRSLYFSSSAAAVEAERTIREGPRTDWKKEEIKSVYDSPLLDLLFHGAQVHRHAQNFREVQQCTLLSIKTGGCSEDCSYCPQSSRYDTGLKAQKLMNKDAVLEAAQKAKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKEIRGMGMEVCCTLGMIEKQQAVQLKKAGLTAYNHNLDTSREYYPNVITTRSYDERLETISHVREAGINVCSGGIIGLGEAEEDRVGLLHTLATLPSHPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G421780`
TK1151 ID	TkA02G421780
OH-1004 ID	LXL04_014490
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 88.706 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G421780

Location Chr02:107098528-107101909 (+)

Description Similar to BIO2: Biotin synthase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43360`	Biotin synthase, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014490 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009102 biotin biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0004076 biotin synthase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ana:alr1921

ani:ANIA_06643

ath:AT2G43360

chu:CHU_2466

spo:2538717

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.922

Rank 1 · TkA02G421780 · TK1151

Cytoplasm0.078

Rank 2 · TkA02G421780 · TK1151

Nucleus0.064

Rank 3 · TkA02G421780 · TK1151

Plastid0.050

Rank 4 · TkA02G421780 · TK1151

Cell membrane0.024

Rank 5 · TkA02G421780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15459RRP148-53 aa

PF30032MMS1_N52-93 aa

PF04055Radical_SAM89-251 aa

PF12134PRP8_domainIV111-188 aa

PF15459RRP14112-131 aa

PF06968BATS263-353 aa

PF04055Radical_SAM267-296 aa

PF15459RRP14349-356 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G421780	`PF15459`	RRP14	8	53	0.33	12.3
TkA02G421780	`PF30032`	MMS1_N	52	93	0.15	11.4
TkA02G421780	`PF04055`	Radical_SAM	89	251	1.4e-21	78.0
TkA02G421780	`PF12134`	PRP8_domainIV	111	188	0.1	12.9
TkA02G421780	`PF15459`	RRP14	112	131	0.33	12.3
TkA02G421780	`PF06968`	BATS	263	353	4e-27	94.9
TkA02G421780	`PF04055`	Radical_SAM	267	296	1.4e-21	78.0
TkA02G421780	`PF15459`	RRP14	349	356	0.33	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P54967`	Arabidopsis thaliana	sp\|P54967\|BIOB_ARATH Biotin synthase, mitochondrial	85.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card