TkA02G418190 | RubberDandelionOmics

Gene overview

TkA02G418190

Reference: TK1151 Chr: Chr02 Coordinates: 106293719-106295834 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

685 bp · TkA02G418190|TK1151|cDNA

ATGGAAAAGTACAAGCATCTATTGCCATCGATTGCAGGATCAAGTATATCAGAATCTGTGATTAAAAAGAAATACGGTCTGGATGCAACAAATGTTGGTGATGAATATGGCTTTGCTCCTAACATTCAGGAAAATAAAGAGGTCTTGAATTGCTTAAGACAGCAATTGCTAAAGCTAGATACACCGGAAAGGCTGTCATTGGGGGCGGAGGCAAACGGAACAGAGGAGAACCCGTCGGCTACGGTGTCGGAACACGTGGA...

CDS

Download CDS FASTA

585 bp · TkA02G418190|TK1151|CDS

ATGGAAAAGTACAAGCATCTATTGCCATCGATTGCAGGATCAAGTATATCAGAATCTGTGATTAAAAAGAAATACGGTCTGGATGCAACAAATGTTGGTGATGAATATGGCTTTGCTCCTAACATTCAGGAAAATAAAGAGGTCTTGAATTGCTTAAGACAGCAATTGCTAAAGCTAGATACACCGGAAAGGCTGTCATTGGGGGCGGAGGCAAACGGAACAGAGGAGAACCCGTCGGCTACGGTGTCGGAACACGTGGA...

Protein

Download Protein FASTA

194 aa · TkA02G418190|TK1151|PROTEIN

MEKYKHLLPSIAGSSISESVIKKKYGLDATNVGDEYGFAPNIQENKEVLNCLRQQLLKLDTPERLSLGAEANGTEENPSATVSEHVDALLEAARYNDIDVVNSLAAIGVSLNSKDEEGRKALHMASANGNVNIVNYLISNNVVVNILILARAEVSSLNSHVRTPVDEAAIGGKMDVIDAINIAVAQMELTRTSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G418190`
TK1151 ID	TkA02G418190
OH-1004 ID	LXL04_014505
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G418190

Location Chr02:106293719-106295834 (-)

Description Similar to ENO2: Enolase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36530`	Multifunctional enzyme that acts as an enolase involved in the metabolism and as a positive regulator of cold-responsive gene transcription.	LOS2, a genetic locus required for cold-responsive gene transcription encodes a bi-functional enolase.2002 · DOI: 10.1093/emboj/21.11.2692 Quantitative proteomics of the tonoplast reveals a role for glycolytic enzymes in salt tolerance.2009 · DOI: 10.1105/tpc.109.069211

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014505 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

KEGG gene cross-reference

ath:AT2G36530

rcu:8288376

zma:542316

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.566

Rank 1 · TkA02G418190 · TK1151

Cytoplasm0.464

Rank 2 · TkA02G418190 · TK1151

Mitochondrion0.051

Rank 3 · TkA02G418190 · TK1151

Cell membrane0.049

Rank 4 · TkA02G418190 · TK1151

Endoplasmic reticulum0.036

Rank 5 · TkA02G418190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00113Enolase_C18-57 aa

PF13857Ank_536-45 aa

PF12796Ank_286-145 aa

PF00023Ank88-115 aa

PF13606Ank_388-112 aa

PF12796Ank_289-177 aa

PF13637Ank_490-138 aa

PF13857Ank_592-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G418190	`PF00113`	Enolase_C	18	57	2e-09	37.9
TkA02G418190	`PF13857`	Ank_5	36	45	7.8e-07	30.1
TkA02G418190	`PF12796`	Ank_2	86	145	7e-18	65.7
TkA02G418190	`PF00023`	Ank	88	115	4.4e-08	33.7
TkA02G418190	`PF13606`	Ank_3	88	112	8.4e-08	32.6
TkA02G418190	`PF12796`	Ank_2	89	177	7e-18	65.7
TkA02G418190	`PF13637`	Ank_4	90	138	4e-11	43.6
TkA02G418190	`PF13857`	Ank_5	92	118	7.8e-07	30.1
TkA02G418190	`PF13857`	Ank_5	104	143	7.8e-07	30.1
TkA02G418190	`PF13606`	Ank_3	117	145	8.4e-08	32.6
TkA02G418190	`PF00023`	Ank	118	146	4.4e-08	33.7
TkA02G418190	`PF13637`	Ank_4	145	177	4e-11	43.6
TkA02G418190	`PF00023`	Ank	162	178	4.4e-08	33.7
TkA02G418190	`PF13606`	Ank_3	162	180	8.4e-08	32.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P25696`	Arabidopsis thaliana	sp\|P25696\|ENO2_ARATH Bifunctional enolase 2/transcriptional activator	55.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card