TkA02G416830 | RubberDandelionOmics

Gene overview

TkA02G416830

Reference: TK1151 Chr: Chr02 Coordinates: 105941406-105948129 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1305 bp · TkA02G416830|TK1151|cDNA

ATGGTGCAAACTCAACCTCATTTCCTCTTAGTAACTTATCCAGCCCAAGGTCACATCAACCCAACTCTCCAGTTCGCTAAACGTCTCCTCCGATTAGGTGTCAAAGTCACCTTCGCCACCTGCATCTCCGCCTACCGCCGCATGAGCAAAACTGGCCGGATTCCAGACTGTTTGAACTTCGCTGCTTTTTCCGACGGCTTTGACGACGGCTATAACTACAAGAACAATGATCACTCATTATACCTGAGTCAATTGAAAAC...

CDS

Download CDS FASTA

1305 bp · TkA02G416830|TK1151|CDS

ATGGTGCAAACTCAACCTCATTTCCTCTTAGTAACTTATCCAGCCCAAGGTCACATCAACCCAACTCTCCAGTTCGCTAAACGTCTCCTCCGATTAGGTGTCAAAGTCACCTTCGCCACCTGCATCTCCGCCTACCGCCGCATGAGCAAAACTGGCCGGATTCCAGACTGTTTGAACTTCGCTGCTTTTTCCGACGGCTTTGACGACGGCTATAACTACAAGAACAATGATCACTCATTATACCTGAGTCAATTGAAAAC...

Protein

Download Protein FASTA

434 aa · TkA02G416830|TK1151|PROTEIN

MVQTQPHFLLVTYPAQGHINPTLQFAKRLLRLGVKVTFATCISAYRRMSKTGRIPDCLNFAAFSDGFDDGYNYKNNDHSLYLSQLKTLGSQSLKETILSCAKDGTPVTCLVYTILLPWAEEVARYDKLIGDDSKDPSWSLQVPGLPSLKSRDLPSFCLPSNTYSFILPLFKEQVDMLDSEDRPKILVNTFDELEKDALKEIDGKLKMLGVGPLIPSAFLDGKDLSDTSFGGDLFETSKDYTEWMNTKPERSILYISFGSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G416830`
TK1151 ID	TkA02G416830
OH-1004 ID	LXL04_014526
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	55.100
Protein coverage (%)	TK1151 99.309 / OH-1004 99.774 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G416830`
Location	Chr02:105941406-105948129 (-)
Description	Similar to UGT75C1: UDP-glycosyltransferase 75C1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014526` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009698 phenylpropanoid metabolic process Biological Process GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process GO:0009835 fruit ripening Biological Process GO:0009845 seed germination Biological Process GO:0080148 negative regulation of response to water deprivation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0008194 UDP-glycosyltransferase activity Molecular Function
KEGG gene cross-reference	ag:BAK55736 ath:AT4G14090 mdm:103443397 sly:101250450 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.644

Rank 1 · TkA02G416830 · TK1151

Nucleus0.190

Rank 2 · TkA02G416830 · TK1151

Peroxisome0.094

Rank 3 · TkA02G416830 · TK1151

Endoplasmic reticulum0.089

Rank 4 · TkA02G416830 · TK1151

Plastid0.076

Rank 5 · TkA02G416830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N10-46 aa

PF26168Glyco_transf_N185-215 aa

PF00201UDPGT237-393 aa

PF13692Glyco_trans_1_4257-350 aa

PF06722EryCIII-like_C309-395 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G416830	`PF26168`	Glyco_transf_N	10	46	0.0016	19.1
TkA02G416830	`PF26168`	Glyco_transf_N	185	215	0.0016	19.1
TkA02G416830	`PF00201`	UDPGT	237	393	1.3e-25	90.9
TkA02G416830	`PF13692`	Glyco_trans_1_4	257	350	0.024	15.6
TkA02G416830	`PF06722`	EryCIII-like_C	309	395	0.00027	21.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card