TkA02G415640 | RubberDandelionOmics

Gene overview

TkA02G415640

Reference: TK1151 Chr: Chr02 Coordinates: 105643880-105646558 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1569 bp · TkA02G415640|TK1151|cDNA

GAAAAAAAAAACAAACATATATAACTAAGAGGCTAGTACTAGTCTTGGTCTATATTATATATATACCCACCCATTGAACCAAAATCATCGTTTAATCTTCTTTTGCCTCCATCTTCTCTATACAACAATATACAAAATGGGTTTCTCGAAAGAAGAAAGCCCGGTCTTTGACATCAAGATATCATCGGTTGGACCGGGATACATATCTGGTCAAGGTGCAGTTCAAGAGCTAACCGGCATGGACTTAGCCATGAAGCTTC...

CDS

Download CDS FASTA

1293 bp · TkA02G415640|TK1151|CDS

ATGGGTTTCTCGAAAGAAGAAAGCCCGGTCTTTGACATCAAGATATCATCGGTTGGACCGGGATACATATCTGGTCAAGGTGCAGTTCAAGAGCTAACCGGCATGGACTTAGCCATGAAGCTTCACTACATACGAACGGTTTACTATTTTCGAAGCCAAGCGTTTGAAGGGTTAACCATCATTAACATTAAGGAGACCATATTCTACTGGCTGAACAATGCTTATGTTACATGTGGCCGGTTTAGAAGGACCGAGTCAGG...

Protein

Download Protein FASTA

430 aa · TkA02G415640|TK1151|PROTEIN

MGFSKEESPVFDIKISSVGPGYISGQGAVQELTGMDLAMKLHYIRTVYYFRSQAFEGLTIINIKETIFYWLNNAYVTCGRFRRTESGRPYIKCNDCGVRFIEARCRLSLDEWLQLKDDSKHKLLVPNQVLGPDLPYSPLVLMQLTKFKCGGTSVGVSWAHVLGDVFSFATYMNLWGQSTRHHYPTQPFRMAHSVKEDYNPKSIPKDLIAVKQVGPMGDHWTTPDNTKLETYCFHLSYPELTRLQSKIYGGKNPQQIPPFE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G415640`
TK1151 ID	TkA02G415640
OH-1004 ID	LXL04_014541
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	70.400
Protein coverage (%)	TK1151 99.767 / OH-1004 99.767 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G415640

Location Chr02:105643880-105646558 (+)

Description Similar to CER26: Protein ECERIFERUM 26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13840`	Involved in biosynthesis of the epicuticular wax.	The Arabidopsis cer26 mutant, like the cer2 mutant, is specifically affected in the very long chain fatty acid elongation process.2013 · DOI: 10.1111/tpj.12060
`At3g23840`	Involved in biosynthesis of the epicuticular wax.	No verified direct reference in this release
`At4g24510`	Involved in biosynthesis of the epicuticular wax.	Composition of alkyl esters in the cuticular wax on inflorescence stems of Arabidopsis thaliana cer mutants.2007 · DOI: 10.1111/j.1365-313x.2007.03054.x Arabidopsis ECERIFERUM2 is a component of the fatty acid elongation machinery required for fatty acid extension to exceptional lengths.2012 · DOI: 10.1104/pp.112.201640 The Arabidopsis cer26 mutant, like the cer2 mutant, is specifically affected in the very long chain fatty acid elongation process.2013 · DOI: 10.1111/tpj.12060

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014541 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

KEGG gene cross-reference

ath:AT3G23840

ath:AT4G13840

ath:AT4G24510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.491

Rank 1 · TkA02G415640 · TK1151

Nucleus0.343

Rank 2 · TkA02G415640 · TK1151

Cell membrane0.157

Rank 3 · TkA02G415640 · TK1151

Endoplasmic reticulum0.097

Rank 4 · TkA02G415640 · TK1151

Golgi apparatus0.063

Rank 5 · TkA02G415640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458Transferase32-420 aa

PF23549Zn_ribbon_GRF_286-101 aa

PF17987PMT2_N267-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G415640	`PF02458`	Transferase	32	420	5.5e-40	138.1
TkA02G415640	`PF23549`	Zn_ribbon_GRF_2	86	101	0.18	12.3
TkA02G415640	`PF17987`	PMT2_N	267	344	0.014	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVM9`	Arabidopsis thaliana	sp\|Q9SVM9\|CER26_ARATH Protein ECERIFERUM 26	38.000%	Swiss-Prot	Medium
`Q9LIS1`	Arabidopsis thaliana	sp\|Q9LIS1\|CR26L_ARATH Protein ECERIFERUM 26-like	37.000%	Swiss-Prot	Medium
`Q39048`	Arabidopsis thaliana	sp\|Q39048\|CER2_ARATH Protein ECERIFERUM 2	36.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card