TkA02G407920 | RubberDandelionOmics

Gene overview

TkA02G407920

Reference: TK1151 Chr: Chr02 Coordinates: 103740900-103747340 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2603 bp · TkA02G407920|TK1151|cDNA

AGACAGGTACGTACCTGACAACTTCCTTTATATATATCCGATACCACAAGATATACTCCTCACACAACGTAATTTAGAGAGAGAAAACAAGATGCATGACCAAATTAAGAGACAGTGTCACCCTCTCTTAGGAGGTGAGAGAGATGAAGAGCCGAACAATGGAAGCTTTTCATCATCAGAAATGGCGACTCTGGGCAGCATATGTGACGTATTCGTGCAGCCACTTCCTTTGAATTCTCTTGATGATCATGCCGATAAAG...

CDS

Download CDS FASTA

1176 bp · TkA02G407920|TK1151|CDS

ATGGAAAAAGTGTGTGAAAGAATCGGCGTTACTGGAAAATGCACAAAAGAAGGGTTCCAAAATCAAGTTCTTCGTAAAGGGTGTGAGAATCTTGGGTTAAAAGTCGATTATGTCCCACAGAACTCATCGGAGAATCATTACTGTGGTTCATGTTGTTATGGTTGCAGATCAGGAGACAAAAAGGGAACCGATTCGACTTGGTTGGTTGACGCAGTGGATCATGGCGCCGTTATTATAACCGGATGTAAAGCCAAGAACTT...

Protein

Download Protein FASTA

391 aa · TkA02G407920|TK1151|PROTEIN

MEKVCERIGVTGKCTKEGFQNQVLRKGCENLGLKVDYVPQNSSENHYCGSCCYGCRSGDKKGTDSTWLVDAVDHGAVIITGCKAKNFMLTRNQQGNKRKHKCLGVIAQVLNQYILKTLHIEAKVTISACGSLLTPPLMISSGLKNPNIGRNLHLHPVAMAWGYFPESETTDLTGTIYEGGILTSVHEPESHETYILEVPSLGPGSFAGLCSWISGKDFKERMLKYSRTAHVFSMVRDSGSGKVTTAGKISYKFSESDTQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G407920`
TK1151 ID	TkA02G407920
OH-1004 ID	LXL04_014622
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 52.695 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G407920

Location Chr02:103740900-103747340 (+)

Description Similar to FAO1: Long-chain-alcohol oxidase FAO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23410`	Long-chain fatty alcohol oxidase involved in the omega- oxidation pathway of lipid degradation.	Functional identification of AtFao3, a membrane bound long chain alcohol oxidase in Arabidopsis thaliana.2004 · DOI: 10.1016/j.febslet.2004.07.086 Cloning and characterization of long-chain fatty alcohol oxidase LjFAO1 in lotus japonicus.2008 · DOI: 10.1021/bp0703533
`At4g28570`	Long-chain fatty alcohol oxidase involved in the omega-oxidation pathway of lipid degradation.	No verified direct reference in this release
`At1g03990`	Long-chain fatty alcohol oxidase involved in the omega-oxidation pathway of lipid degradation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014622 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006066 alcohol metabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0016020 membrane Cellular Component

GO:0046577 long-chain-alcohol oxidase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

KEGG gene cross-reference

ag:CAP15762

ath:AT1G03990

ath:AT3G23410

ath:AT4G28570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.413

Rank 1 · TkA02G407920 · TK1151

Peroxisome0.368

Rank 2 · TkA02G407920 · TK1151

Cytoplasm0.164

Rank 3 · TkA02G407920 · TK1151

Nucleus0.072

Rank 4 · TkA02G407920 · TK1151

Cell membrane0.048

Rank 5 · TkA02G407920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00732GMC_oxred_N1-157 aa

PF05199GMC_oxred_C42-67 aa

PF02662FlpD64-116 aa

PF11039DUF2824175-238 aa

PF05199GMC_oxred_C248-379 aa

PF00732GMC_oxred_N258-279 aa

PF02662FlpD286-309 aa

PF00732GMC_oxred_N299-338 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G407920	`PF00732`	GMC_oxred_N	1	157	1.1e-48	166.7
TkA02G407920	`PF05199`	GMC_oxred_C	42	67	2.9e-24	86.9
TkA02G407920	`PF02662`	FlpD	64	116	0.082	13.6
TkA02G407920	`PF11039`	DUF2824	175	238	0.071	13.8
TkA02G407920	`PF05199`	GMC_oxred_C	248	379	2.9e-24	86.9
TkA02G407920	`PF00732`	GMC_oxred_N	258	279	1.1e-48	166.7
TkA02G407920	`PF02662`	FlpD	286	309	0.082	13.6
TkA02G407920	`PF00732`	GMC_oxred_N	299	338	1.1e-48	166.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW56`	Arabidopsis thaliana	sp\|Q9LW56\|FAO3_ARATH Long-chain-alcohol oxidase FAO3	62.900%	Swiss-Prot	High
`Q94BP3`	Arabidopsis thaliana	sp\|Q94BP3\|FAO4B_ARATH Long-chain-alcohol oxidase FAO4B	61.700%	Swiss-Prot	High
`Q9ZWB9`	Arabidopsis thaliana	sp\|Q9ZWB9\|FAO1_ARATH Long-chain-alcohol oxidase FAO1	58.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card