TkA02G406890 | RubberDandelionOmics

Gene overview

TkA02G406890

Reference: TK1151 Chr: Chr02 Coordinates: 103468078-103473917 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2205 bp · TkA02G406890|TK1151|cDNA

GAAAGTATGAAACCGTTGACGAACACCGCAGCCCTTTCTTCTCGACGGACTGAGCACTAGAACTTTGACTTTTTCCAGTCTTGTTCTTGGTCCTCTCTACAGTTCTTCCCCATTTCCGACACCTCGATCGCGATTGTTCGTTGGGCTTAGCGCCAGGTGATCTAAGATACCAAGGTTCTAATAAAATCAAAAAGGTATGGGAGCACGTTCTTCAAAGAGTTCAACCTCTAAAAAAGTGTCATCACATGCACATGGAGATC...

CDS

Download CDS FASTA

1743 bp · TkA02G406890|TK1151|CDS

ATGGGAGCACGTTCTTCAAAGAGTTCAACCTCTAAAAAAGTGTCATCACATGCACATGGAGATCATGGTACGGGTATACAACCACATGAATTAAAACAATCACATTTGCAACAAGATTCAACTCCTTCAATGAGCACTTATAGTTCCACTATTGAAAAAGATCAAACAAAAGATCCCATTTCTAACCCTAAAACAACCGTGTCCGAATATAATACCAAAGAGGATGATTTTTATGATGGAATACCTCGCATCCCCATGAC...

Protein

Download Protein FASTA

580 aa · TkA02G406890|TK1151|PROTEIN

MGARSSKSSTSKKVSSHAHGDHGTGIQPHELKQSHLQQDSTPSMSTYSSTIEKDQTKDPISNPKTTVSEYNTKEDDFYDGIPRIPMTLSEKSRSRSFRVSARKAGSIGIEKAVGVLDTLGSSVTNLNSRSAFVTGPTTKGNELSILSFEVANTIMKGSSLMNFLSNGNIKHLKEVVFVSEGVQNLVSKDVDELLRTVAADKRAELKIFSGEVVRFGNRCKDPQWHNLDVYFEKQNRGLTRAKQLKGDPEVVMEQLLTLVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G406890`
TK1151 ID	TkA02G406890
OH-1004 ID	LXL04_014640
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G406890

Location Chr02:103468078-103473917 (-)

Description Similar to PSI1: Protein PSK SIMULATOR 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08660`	Promotes plant growth, especially at the vegetative stage, probably via the regulation of phytosulfokine (PSK) signaling; PSK are peptide phytohormones acting as growth factors.	The PSI family of nuclear proteins is required for growth in arabidopsis.2014 · DOI: 10.1007/s11103-014-0229-2
`At1g34320`	Promotes seedling growth probably via the regulation of phytosulfokine (PSK) signaling.	The PSI family of nuclear proteins is required for growth in arabidopsis.2014 · DOI: 10.1007/s11103-014-0229-2
`At1g30755`	Promotes seedling growth probably via the regulation of phytosulfokine (PSK) signaling.	The PSI family of nuclear proteins is required for growth in arabidopsis.2014 · DOI: 10.1007/s11103-014-0229-2

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014640 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006109 regulation of carbohydrate metabolic process Biological Process

GO:0009744 response to sucrose Biological Process

GO:0043434 response to peptide hormone Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003746 translation elongation factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G30755

ath:AT1G34320

ath:AT5G08660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.420

Rank 1 · TkA02G406890 · TK1151

Cell membrane0.367

Rank 2 · TkA02G406890 · TK1151

Nucleus0.296

Rank 3 · TkA02G406890 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA02G406890 · TK1151

Golgi apparatus0.059

Rank 5 · TkA02G406890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05746DALR_151-97 aa

PF05003DUF66870-98 aa

PF22936Pol_BBD120-187 aa

PF11961DUF3475145-201 aa

PF05746DALR_1245-278 aa

PF05746DALR_1308-360 aa

PF05003DUF668319-332 aa

PF05003DUF668366-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G406890	`PF05746`	DALR_1	51	97	0.18	12.6
TkA02G406890	`PF05003`	DUF668	70	98	4.3e-25	88.7
TkA02G406890	`PF22936`	Pol_BBD	120	187	0.089	13.9
TkA02G406890	`PF11961`	DUF3475	145	201	2.6e-20	72.9
TkA02G406890	`PF05746`	DALR_1	245	278	0.18	12.6
TkA02G406890	`PF05746`	DALR_1	308	360	0.18	12.6
TkA02G406890	`PF05003`	DUF668	319	332	4.3e-25	88.7
TkA02G406890	`PF05003`	DUF668	366	450	4.3e-25	88.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DO24`	Arabidopsis thaliana	sp\|P0DO24\|PSI3_ARATH Protein PSK SIMULATOR 3	55.400%	Swiss-Prot	High
`Q9XID5`	Arabidopsis thaliana	sp\|Q9XID5\|PSI1_ARATH Protein PSK SIMULATOR 1	54.600%	Swiss-Prot	High
`Q9SA91`	Arabidopsis thaliana	sp\|Q9SA91\|PSI2_ARATH Protein PSK SIMULATOR 2	44.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card