TkA02G406840 | RubberDandelionOmics

Gene overview

TkA02G406840

Reference: TK1151 Chr: Chr02 Coordinates: 103448355-103452075 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3038 bp · TkA02G406840|TK1151|cDNA

ATGAGATGGGATATAAGATTTTAGTTTTAGTGGGTGGATGCTTGTATTTTATGACTTTTTGGCTTCTTGGGAATTGGCTTCTACACACAAAGCTTCAACATTGGCTGCTGTTGTGTGGCTCATTTCACAAAAGAAAGCATTAGATGATTGATAATTCCTATGCTTAGTTTTGTCTCCTTCCATTAAACAGTGGCACACCTTTTTCTGCTCATCTTCCTTCTTCTTCTTCTTCTTCACTTAGCAACTAGCATCCATCAAGA...

CDS

Download CDS FASTA

1914 bp · TkA02G406840|TK1151|CDS

ATGGTATCTAACAATAATACATGTGGGTCAAAGCTGCTTCTAGCTTTACCGGATGATATCTTTGCGGTTGTAACGCGATCTCTTACACCCAAAGACGTGTTTAACCTTTCTATCTGTTGCCGGAGTCTTTATACTCTTGCAAGTTCCGATAAAGTATGGTTAACACAATGCGAATTGCTTGGTGTGATCCCCCATCGAGATCTTATCGAGTGGCGAAAAGGGGTTAATTCCTACAAATCTCTTTGTAGGTTTCTCATTAA...

Protein

Download Protein FASTA

637 aa · TkA02G406840|TK1151|PROTEIN

MVSNNNTCGSKLLLALPDDIFAVVTRSLTPKDVFNLSICCRSLYTLASSDKVWLTQCELLGVIPHRDLIEWRKGVNSYKSLCRFLINVRPIIGIWVHQNPELGNVVYVMPGFISVVGCRIIPQELGPLGIEEGPILWSPVFEIIGDVDGSSVFLLHGRERENNYIYPGSMKTVNRNCNVLLLEVEPRQQKNGGKLVHSKSFAGNSVDKDFSRKICPSERGISKSQRCHGQKPSVPFSKLAFGDRRKLIEIVTSQIRVQVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G406840`
TK1151 ID	TkA02G406840
OH-1004 ID	LXL04_014643
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G406840

Location Chr02:103448355-103452075 (+)

Description Similar to At5g39450: F-box protein At5g39450

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39450`	F-box protein At5g39450.	No verified direct reference in this release
`At5g39460`	Putative F-box protein At5g39460.	No verified direct reference in this release
`At5g39480`	Putative F-box protein At5g39480.	No verified direct reference in this release
`At5g39490`	Probable F-box protein At5g39490.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014643 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0009536 plastid Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT5G39450

ath:AT5G39460

ath:AT5G39470

ath:AT5G39480

ath:AT5G39490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.524

Rank 1 · TkA02G406840 · TK1151

Cytoplasm0.329

Rank 2 · TkA02G406840 · TK1151

Cell membrane0.123

Rank 3 · TkA02G406840 · TK1151

Endoplasmic reticulum0.088

Rank 4 · TkA02G406840 · TK1151

Mitochondrion0.064

Rank 5 · TkA02G406840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box13-54 aa

PF12937F-box-like14-57 aa

PF12014Cyclin_D1_bind511-561 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G406840	`PF00646`	F-box	13	54	1.5e-06	28.6
TkA02G406840	`PF12937`	F-box-like	14	57	1.7e-05	25.2
TkA02G406840	`PF12014`	Cyclin_D1_bind	511	561	0.0017	19.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWD6`	Arabidopsis thaliana	sp\|Q8RWD6\|FB271_ARATH F-box protein At5g39450	49.300%	Swiss-Prot	Medium
`Q9FLZ1`	Arabidopsis thaliana	sp\|Q9FLZ1\|FB272_ARATH Putative F-box protein At5g39460	43.900%	Swiss-Prot	Medium
`Q9FLY8`	Arabidopsis thaliana	sp\|Q9FLY8\|FB274_ARATH Putative F-box protein At5g39480	43.300%	Swiss-Prot	Medium
`Q9FLY7`	Arabidopsis thaliana	sp\|Q9FLY7\|FB338_ARATH Probable F-box protein At5g39490	41.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card