RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G406010
Reference: TK1151 Chr: Chr02 Coordinates: 103183528-103187083 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1943 bp · TkA02G406010|TK1151|cDNA

GAAAGACTCTCTTATTATTTAAAGTTGAAGCAGGTACATGTTACATCTCAGCACACATGGGACCCGATGTGGAGGGTGTCAGATCATATTTGGATGTTGTTGGACGGCATGATAAACAACGACAACAAAGGCTGCATCATCGATTATCCTCTTACCTAACAAATCATACTTCCCAACAATCTTCTGTTGTCTACCATCATTCAAACTTTCTTCTGTTTCTCTGCTCCTTCTCAATTTCACTGAATCCAGTTGTTTCGAGG...

CDS

Download CDS FASTA

1320 bp · TkA02G406010|TK1151|CDS

ATGAGTACTCCCAAAATCAAGCGTAGAGTGGGTAAATACGAGATGGGAAGAACAATCGGTGAGGGAACTTTTGCGAAAGTGAAGTTTGCTAGGAATTCTGAAACTGGGGAACCTGTGGCTATTAAGATCCTTGACAAAGAAAAAGTTGTTAAACACAAAATGGCTGAACAGATAAAAATGGAAATAGCTACAATGAAGTTGATAAAGCATCCAAATGTCGTCCGCTTATACGAGGTTATGGGGAGCAAGACCAAGATATT...

Protein

Download Protein FASTA

439 aa · TkA02G406010|TK1151|PROTEIN

MSTPKIKRRVGKYEMGRTIGEGTFAKVKFARNSETGEPVAIKILDKEKVVKHKMAEQIKMEIATMKLIKHPNVVRLYEVMGSKTKIFIILEFVTGGELFDKIVNHGRMHEDEARKYFQQLINAVDYCHSRGVYHRDLKPENLLLDASGNLKVSDFGLSAVSRQVRDDGLLHTTCGTPNYVAPEVLNDRGYDGATADLWSCGVILFVLLAGYLPFDDSNLMNLYKKISAAEFTCPPWISFSAIKLITRILDPNPMTRITVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G406010
TK1151 IDTkA02G406010
OH-1004 IDLXL04_031095
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)57.800
Protein coverage (%)TK1151 96.811 / OH-1004 95.312
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G406010
LocationChr02:103183528-103187083 (-)
DescriptionSimilar to CIPK8: CBL-interacting serine/threonine-protein kinase 8
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g26980 May regulate cold- and salt-induced genes in seedling salt and hyperosmotic stress responses.
CIPK3, a calcium sensor-associated protein kinase that regulates abscisic acid and cold signal transduction in Arabidopsis.2003 · DOI: 10.1105/tpc.006858
At5g21326 CIPK serine-threonine protein kinases interact with CBL proteins.
The Calcineurin B-like calcium sensors CBL1 and CBL9 together with their interacting protein kinase CIPK26 regulate the Arabidopsis NADPH oxidase RBOHF.2013 · DOI: 10.1093/mp/sst009

Rice

Reference gene IDPossible functionPapers / DOI
Os12g0132200 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release
Os11g0134300 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release
Os03g0319400 Involved in cold stress tolerance. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031095 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0007165 signal transduction Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009749 response to glucose Biological Process
GO:0010167 response to nitrate Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0048364 root development Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0009705 plant-type vacuole membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT4G24400
ath:AT5G35410
dosa:Os01g0536000
dosa:Os06g0606000
dosa:Os07g0150700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.522
Rank 1 · TkA02G406010 · TK1151
Nucleus0.412
Rank 2 · TkA02G406010 · TK1151
Cell membrane0.272
Rank 3 · TkA02G406010 · TK1151
Golgi apparatus0.050
Rank 4 · TkA02G406010 · TK1151
Endoplasmic reticulum0.048
Rank 5 · TkA02G406010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase13-268 aa
PF07714PK_Tyr_Ser-Thr14-264 aa
PF14531Kinase-like16-72 aa
PF03109ABC119-69 aa
PF14303NAM-associated43-57 aa
PF01636APH52-123 aa
PF03109ABC154-160 aa
PF06293Kdo78-149 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G406010PF00069Pkinase132681.2e-75255.0
TkA02G406010PF07714PK_Tyr_Ser-Thr142642.4e-37129.4
TkA02G406010PF14531Kinase-like16724.5e-0730.1
TkA02G406010PF03109ABC119696.7e-0522.9
TkA02G406010PF14303NAM-associated43578.9e-0730.6
TkA02G406010PF01636APH521230.06513.7
TkA02G406010PF03109ABC1541606.7e-0522.9
TkA02G406010PF06293Kdo781490.003617.5
TkA02G406010PF14531Kinase-like1072164.5e-0730.1
TkA02G406010PF01636APH1211560.06513.7
TkA02G406010PF14303NAM-associated2714198.9e-0730.6
TkA02G406010PF03822NAF3083672.6e-2485.8
TkA02G406010PF02149KA13974240.02215.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q2V452Arabidopsis thalianasp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 381.600%Swiss-ProtHigh
Q84VQ3Arabidopsis thalianasp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 2677.800%Swiss-ProtHigh
Q2QY53Oryza sativa subsp. japonicasp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 3282.900%Swiss-ProtHigh
Q2RAX3Oryza sativa subsp. japonicasp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 3380.000%Swiss-ProtHigh
Q6X4A2Oryza sativa subsp. japonicasp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 3174.400%Swiss-ProtHigh

JBrowse

View in Genome Browser